Neurotensin Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33903

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Neurotensin Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: DFLTNMHTSKLIQEDILDTGNDKNGKEEVIKRKIPYILKRQLYENKPRRP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Neurotensin Antibody - BSA Free

Immunohistochemistry-Paraffin: Neurotensin Antibody [NBP2-33903]

Immunohistochemistry-Paraffin: Neurotensin Antibody [NBP2-33903]

Immunohistochemistry-Paraffin: Neurotensin Antibody [NBP2-33903] - Analysis in human small intestine and skeletal muscle tissues. Corresponding NTS RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Neurotensin Antibody [NBP2-33903]

Immunohistochemistry-Paraffin: Neurotensin Antibody [NBP2-33903]

Immunohistochemistry-Paraffin: Neurotensin Antibody [NBP2-33903] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Immunohistochemistry-Paraffin: Neurotensin Antibody [NBP2-33903]

Immunohistochemistry-Paraffin: Neurotensin Antibody [NBP2-33903]

Immunohistochemistry-Paraffin: Neurotensin Antibody [NBP2-33903] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: Neurotensin Antibody [NBP2-33903]

Immunohistochemistry-Paraffin: Neurotensin Antibody [NBP2-33903]

Immunohistochemistry-Paraffin: Neurotensin Antibody [NBP2-33903] - Staining of human tonsil shows no positivity in lymphoid cells as expected.
Immunohistochemistry-Paraffin: Neurotensin Antibody [NBP2-33903]

Immunohistochemistry-Paraffin: Neurotensin Antibody [NBP2-33903]

Immunohistochemistry-Paraffin: Neurotensin Antibody [NBP2-33903] - Staining of human small intestine shows strong cytoplasmic positivity in endocrine glandular cells.

Applications for Neurotensin Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Neurotensin

Neurotensin, also known as neurotensin/neuromedin N and NTS, is a member of the neurotensin family. Neurotensin is the precursor to the neuromedin N and neurotensin peptides. Neurotensin is a secreted tridecapeptide, which is widely distributed throughout the central nervous system, and may function as a neurotransmitter or a neuromodulator. Neurotensin is also involved in the endocrine and paracrine regulation of fat metabolism and smooth muscle contraction. Due to these involvements, neurotensin has been linked to dopamine-associated pathophysiological events.

Long Name

Neurotensin/neuromedin N [Cleaved into: Large neuromedin N

Alternate Names

NTS

Gene Symbol

NTS

UniProt

P30990 (Human)

Additional Neurotensin Products

Product Documents for Neurotensin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Neurotensin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Neurotensin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Neurotensin Antibody - BSA Free and earn rewards!

Have you used Neurotensin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies