Neutrophil Elastase/ELA2 Antibody (8X4E6)

Novus Biologicals | Catalog # NBP3-16724

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA, Immunoprecipitation

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 8X4E6 expressed in HEK293
View all Neutrophil Elastase/ELA2 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 167-267 of human Neutrophil Elastase (ELANE) (P08246). SVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Neutrophil Elastase/ELA2 Antibody (8X4E6)

Western Blot: Neutrophil Elastase/ELA2 Antibody (8X4E6) [NBP3-16724]

Western Blot: Neutrophil Elastase/ELA2 Antibody (8X4E6) [NBP3-16724]

Western Blot: Neutrophil Elastase/ELA2 Antibody (8X4E6) [NBP3-16724] - Analysis of extracts of various cell lines, using Neutrophil Elastase/ELA2 antibody (NBP3-16724) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.

Applications for Neutrophil Elastase/ELA2 Antibody (8X4E6)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1ug/mL

Immunoprecipitation

5μg-4μg antibody for 200μg-400μg extracts of whole cells

Western Blot

1:1000 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Neutrophil Elastase/ELA2

The ELANE gene (commonly known as neutrophil elastase) encodes a 267 amino acid long, 28 kDA neutrophil elastase protein that functions in regulation of natural killer cells, monocytes, and graulocytes. ELANE is involved in activation of proMMP8, cell adhesion cell-matrix glycoconjugates, selected targets of C/EBPbeta, degradation of the extracellular matrix and collagen, and amb2 integrin signaling. It interacts with various genes GZMB, LRP1, SERPINF2, SERPING1, and SERPINA1. Elane has been linked to cystic fibrosis, asthma, pneumonia, alzheimer's disease, neutropenia, cutis laxia, leg ulcers, wegener's granulomatosis, bronchitis, adult respiratory distress syndrome, and vascular diseases.

Alternate Names

ELA2, ELANE, Elastase-2, Leukocyte Elastase, Medullasin

Gene Symbol

ELANE

Additional Neutrophil Elastase/ELA2 Products

Product Documents for Neutrophil Elastase/ELA2 Antibody (8X4E6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Neutrophil Elastase/ELA2 Antibody (8X4E6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Neutrophil Elastase/ELA2 Antibody (8X4E6)

There are currently no reviews for this product. Be the first to review Neutrophil Elastase/ELA2 Antibody (8X4E6) and earn rewards!

Have you used Neutrophil Elastase/ELA2 Antibody (8X4E6)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies