NFkB1/NFkB p105 Antibody - BSA Free

Name: NFkB1/NFkB p105 Antibody - BSA Free
Brand: Novus Biologicals
SKU: NBP3-10287
Price: 389 USD
Availability: InStock

Novus Biologicals | Catalog # NBP3-10287

Submit a review

Product Documents

100% Guarantee

Product Specifications
Scientific Data
Applications
Preparation & Storage
Background
Product Documents
Specific Notices
Research Areas

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free

View all NFkB1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NFkB1/NFkB p105 (NP_003989). Peptide sequence LRDSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYGQEGPLEGK

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

105 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for NFkB1/NFkB p105 Antibody - BSA Free

Western Blot: NFkB1/NFkB p105 Antibody [NBP3-10287]

Western Blot: NFkB1/NFkB p105 Antibody [NBP3-10287] - Western blot analysis using NBP3-10287 on Human THP-1 as a positive control. Antibody Titration: 0.2-1 ug/ml

Applications for NFkB1/NFkB p105 Antibody - BSA Free

Application

Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NFkB1

Nuclear factor kappa beta (NFKB) is a transcription factor that is highly influenced by stress, free-radicals, UV light and hypoxia. Unsurprisingly, NFKB is essential for many human cancers, as it regulates the expression of many downstream proteins that regulate or modify cellular growth and development. NFKB effects on angiogenic pathways and reactive mechanisms to stress and damage are well established throughout literature. Atherosclerosis is partly attributed to the mis-regulation of NFKB in hypoxia. Arthritis is related to inflammation proteins regulated through NFKB. It also has been shown to be important in synapses in brain, leading to memory and cognitive ability or impairment. In all, NFKB is one of the fastest responding transcription factors in humans, and is likely to mediate many responsive events in diseases and injury recovery.

Long Name

Nuclear Factor Kappa-B, Subunit 1

Alternate Names

NF-kB1

Gene Symbol

NFKB1

Additional NFkB1 Products

Product Documents for NFkB1/NFkB p105 Antibody - BSA Free

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NFkB1/NFkB p105 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.