NFYC Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87910

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human NFYC. Peptide sequence: GTQVVQGQIQTLATNAQQITQTEVQQGQQQFSQFTDGQQLYQIQQVTMPA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for NFYC Antibody - BSA Free

Western Blot: NFYC Antibody [NBP2-87910]

Western Blot: NFYC Antibody [NBP2-87910]

Western Blot: NFYC Antibody [NBP2-87910] - WB Suggested Anti-NFYC Antibody Titration: 0.25 ug/ml. Positive Control: 293T cells lysateThere is BioGPS gene expression data showing that NFYC is expressed in HEK293T
Immunohistochemistry: NFYC Antibody [NBP2-87910]

Immunohistochemistry: NFYC Antibody [NBP2-87910]

Immunohistochemistry: NFYC Antibody [NBP2-87910] - Human Liver
Western Blot: NFYC Antibody [NBP2-87910]

Western Blot: NFYC Antibody [NBP2-87910]

Western Blot: NFYC Antibody [NBP2-87910] - Host: Mouse. Target Name: NFYC. Sample Tissue: Mouse Brain. Antibody Dilution: 1ug/ml

Applications for NFYC Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NFYC

NFYC encodes one subunit of a trimeric complex forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoters of a variety of genes. The encoded protein, subunit C, forms a tight dimer with the B subunit, a prerequisite for subunit A association. The resulting trimer binds to DNA with high specificity and affinity. Subunits B and C each contain a histone-like motif. Observation of the histone nature of these subunits is supported by two types of evidence; protein sequence alignments and experiments with mutants. Additional regulation, preliminarily supported by the EST database, may be represented by alternative splicing in this subunit.

Alternate Names

C subunit, nuclear transcription factor Y, gamma

Gene Symbol

NFYC

Additional NFYC Products

Product Documents for NFYC Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NFYC Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NFYC Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NFYC Antibody - BSA Free and earn rewards!

Have you used NFYC Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...