NHE3/SLC9A3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82574

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human, Mouse, Porcine

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin

Cited:

Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Western Blot, Flow Cytometry, Immunocytochemistry/ Immunofluorescence, IF/IHC, SDS-Page

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: DNPVFSPDEALDRSLLARLPPWLSPGETVVPSQRARTQIPYSPGTFCRLMPFRLSSKSVDSFLQADGPEERPPAALPEST

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NHE3/SLC9A3 Antibody - BSA Free

NHE3/SLC9A3 Antibody - BSA Free Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574]

Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574]

Staining of human colon shows strong positivity in apical membrane in glandular cells.
NHE3/SLC9A3 Antibody - BSA Free Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574]

Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574]

Staining of human colon, kidney, liver and small intestine.
NHE3/SLC9A3 Antibody - BSA Free Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574]

Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574]

Staining of human gallbladder shows strong positivity in apical membrane in glandular cells.
NHE3/SLC9A3 Antibody - BSA Free Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574]

Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574]

Staining of human kidney shows weak positivity in apical membrane in cells in tubules.
NHE3/SLC9A3 Antibody - BSA Free Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574]

Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574]

Staining of human liver shows no membranous positivity in hepatocytes as expected.
NHE3/SLC9A3 Antibody - BSA Free Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574]

Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574]

Staining of human small intestine shows strong positivity in apical membrane in glandular cells.

Applications for NHE3/SLC9A3 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NHE3/SLC9A3

NHE3 is a member of the Sodium/Hydrogen exchanger family that plays a crucial role in acid-base and volume homeostasis by mediating the majority of sodium and bicarbonate reabsorption in the proximal tubule of the kidney. Two PKA consensus sites have been discovered in rat NHE3, serine 552 and serine 605. Research suggests that dopamine-induced phosphorylation of these consensus sites inhibit NHE3.

Long Name

Sodium/Hydrogen Exchanger 3

Alternate Names

SLC9A3

Gene Symbol

SLC9A3

Additional NHE3/SLC9A3 Products

Product Documents for NHE3/SLC9A3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NHE3/SLC9A3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Citations for NHE3/SLC9A3 Antibody - BSA Free

Customer Reviews for NHE3/SLC9A3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NHE3/SLC9A3 Antibody - BSA Free and earn rewards!

Have you used NHE3/SLC9A3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NHE3/SLC9A3 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: The molecular weight of NHE3 is 92kDa but I see a band above 100 kDa.  I am confused, because the size of these protein should not be greater than 100KD. Can you please help explain?  

    A: Higher than predicted molecular weight seen on WB is not uncommon if the protein is posttranslationally modified, especially glycosylated, and such is the case for NHE3. Please note that NHE3 gets phosphorylated and glycosylated (Uniprot ID P48764) and potentially, these modifications are adding ~10kDa extra to the predicted molecular weight. If you want to confirm it 100%, you could try de-glycosylating your protein and then performing a WB on it. 

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...