Nicotinamide N-Methyltransferase/NNMT Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55398

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to NNMT(nicotinamide N-methyltransferase) The peptide sequence was selected from the N terminal of NNMT. Peptide sequence MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFC. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Nicotinamide N-Methyltransferase/NNMT Antibody - BSA Free

Western Blot: Nicotinamide N-Methyltransferase/NNMT Antibody [NBP1-55398]

Western Blot: Nicotinamide N-Methyltransferase/NNMT Antibody [NBP1-55398]

Western Blot: Nicotinamide N-Methyltransferase/NNMT Antibody [NBP1-55398] - Reccomended Titration: 2.5 ug/ml Positive Control: HepG2 cell lysate
Immunohistochemistry: Nicotinamide N-Methyltransferase/NNMT Antibody [NBP1-55398]

Immunohistochemistry: Nicotinamide N-Methyltransferase/NNMT Antibody [NBP1-55398]

Immunohistochemistry: Nicotinamide N-Methyltransferase/NNMT Antibody [NBP1-55398] - Human Adult Liver Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 2.0 sec.
Western Blot: Nicotinamide N-Methyltransferase/NNMT Antibody [NBP1-55398]

Western Blot: Nicotinamide N-Methyltransferase/NNMT Antibody [NBP1-55398]

Western Blot: Nicotinamide N-Methyltransferase/NNMT Antibody [NBP1-55398] - Antibody Titration: 0.2-1 ug/ml. A: - blocking peptide. B: + blocking peptide.
Western Blot: Nicotinamide N-Methyltransferase/NNMT Antibody [NBP1-55398]

Western Blot: Nicotinamide N-Methyltransferase/NNMT Antibody [NBP1-55398]

Western Blot: Nicotinamide N-Methyltransferase/NNMT Antibody [NBP1-55398] - Sample Tissue: Human Hela Antibody Dilution: 1.0 ug/ml

Applications for Nicotinamide N-Methyltransferase/NNMT Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Nicotinamide N-Methyltransferase/NNMT

N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver. NNMT responsible for this enzymatic activity which uses S-adenosyl methionine as the methyl donor.N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver. This gene encodes the protein responsible for this enzymatic activity which uses S-adenosyl methionine as the methyl donor.

Long Name

Nicotinamide N-Methyltransferase

Alternate Names

Nicotinamide NMethyltransferase, NNMT

Gene Symbol

NNMT

UniProt

Additional Nicotinamide N-Methyltransferase/NNMT Products

Product Documents for Nicotinamide N-Methyltransferase/NNMT Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Nicotinamide N-Methyltransferase/NNMT Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Nicotinamide N-Methyltransferase/NNMT Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Nicotinamide N-Methyltransferase/NNMT Antibody - BSA Free and earn rewards!

Have you used Nicotinamide N-Methyltransferase/NNMT Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...