Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35674

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Nicotinic Acetylcholine R alpha 4/CHRNA4 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 29-242 of human Nicotinic Acetylcholine R alpha 4/CHRNA4 (P43681).

Sequence:
HVETRAHAEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPADYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAHLFHDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDLVNMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFVIRRL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

70 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody - BSA Free

Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody

Western Blot: Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody [NBP3-35674] -

Western Blot: Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody [NBP3-35674] - Western blot analysis of lysates from mouse kidney, using Nicotinic Acetylcholine R alpha 4/CHRNA4 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody

Immunocytochemistry/ Immunofluorescence: Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody [NBP3-35674] -

Immunocytochemistry/ Immunofluorescence: Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody [NBP3-35674] - Immunofluorescence analysis of L-929 cells using Nicotinic Acetylcholine R alpha 4/CHRNA4 Rabbit pAb at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Nicotinic Acetylcholine R alpha 4/CHRNA4

Nicotinic Acetylcholine Receptor alpha 4 encodes a nicotinic acetylcholine receptor, which belongs to a superfamily of ligand-gated ion channels that play a role in fast signal transmission at synapses. These pentameric receptors can bind acetylcholine, which causes an extensive change in conformation that leads to the opening of an ion-conducting channel across the plasma membrane. This protein is an integral membrane receptor subunit that can interact with either nAChR beta-2 or nAChR beta-4 to form a functional receptor. Mutations in this gene cause nocturnal frontal lobe epilepsy type 1. Polymorphisms in this gene that provide protection against nicotine addiction have been described. [provided by RefSeq]

Long Name

Nicotinic Acetylcholine Receptor alpha 4

Alternate Names

BFNC, CHRNA4, EBN1, ENFL1, nAChR alpha 4, nAchRa4, NACRA4, Nicotinic Acetylcholine Ra4

Gene Symbol

CHRNA4

Additional Nicotinic Acetylcholine R alpha 4/CHRNA4 Products

Product Documents for Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody - BSA Free and earn rewards!

Have you used Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All

  • Q: I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.

    A:

    A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies