Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49128

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: AQRGLSEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody [NBP2-49128]

Immunocytochemistry/ Immunofluorescence: Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody [NBP2-49128]

Immunocytochemistry/Immunofluorescence: Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody [NBP2-49128] - Staining of human cell line U-2 OS shows localization to plasma membrane & focal adhesion sites.

Applications for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Nicotinic Acetylcholine R alpha 5/CHRNA5

Long Name

Nicotinic Acetylcholine Receptor alpha 5

Alternate Names

CHRNA5, NACHRA5, Nicotinic Acetylcholine Ra5

Gene Symbol

CHRNA5

Additional Nicotinic Acetylcholine R alpha 5/CHRNA5 Products

Product Documents for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody - BSA Free and earn rewards!

Have you used Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.

    A:

    A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...