Recombinant Human Nicotinic Acetylcholine Receptor beta 2 GST (N-Term) Protein

Novus Biologicals | Catalog # H00001141-Q01

Novus Biologicals
100% Guarantee

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Applications

Western Blot, ELISA, Affinity Purification, Microarray
View all Nicotinic Acetylcholine R beta 2/CHRNB2 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 26-130 of Human Nicotinic Acetylcholine Receptor beta 2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: TDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVS

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

37.29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation, and Storage

H00001141-Q01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: Nicotinic Acetylcholine R beta 2/CHRNB2

Neuronal acetylcholine receptors are homo- or heteropentameric complexes composed of homologous alpha and beta subunits. They belong to a superfamily of ligand-gated ion channels which allow the flow of sodium and potassium across the plasma membrane in response to ligands such as acetylcholine and nicotine. This gene encodes one of several beta subunits. Mutations in this gene are associated with autosomal dominant nocturnal frontal lobe epilepsy. [provided by RefSeq]

Long Name

Nicotinic Acetylcholine Receptor beta 2

Alternate Names

Cholinergic Receptor Nicotinic Beta 2 Subunit, CHRNB2, EFNL3, NAChRB2, Neuronal Nicotinic Acetylcholine R beta 2

Gene Symbol

CHRNB2

Additional Nicotinic Acetylcholine R beta 2/CHRNB2 Products

Product Documents

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews

There are currently no reviews for this product. Be the first to review Recombinant Human Nicotinic Acetylcholine Receptor beta 2 GST (N-Term) Protein and earn rewards!

Have you used Recombinant Human Nicotinic Acetylcholine Receptor beta 2 GST (N-Term) Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

Showing  1 - 1 of 1 FAQ Showing All

  • Q: I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.

    A:

    A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Proteins and Enzymes