Nidogen-2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55427

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Nidogen-2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PGVWAFHIGSTSPLDNVRPAAVGDLSAAHSSVPLGRSFSHATALESDYNEDNLDYYDVNEEEAEYLPGEPEEALNGHSSIDVSFQSKVDTKP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit Nidogen-2 Antibody - BSA Free (NBP2-55427) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Nidogen-2 Antibody - BSA Free

Western Blot: Nidogen-2 Antibody [NBP2-55427]

Western Blot: Nidogen-2 Antibody [NBP2-55427]

Western Blot: Nidogen-2 Antibody [NBP2-55427] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: Nidogen-2 Antibody [NBP2-55427]

Immunocytochemistry/ Immunofluorescence: Nidogen-2 Antibody [NBP2-55427]

Immunocytochemistry/Immunofluorescence: Nidogen-2 Antibody [NBP2-55427] - Staining of human cell line BJ shows localization to plasma membrane.
Western Blot: Nidogen-2 Antibody [NBP2-55427]

Western Blot: Nidogen-2 Antibody [NBP2-55427]

Western Blot: Nidogen-2 Antibody [NBP2-55427] - Analysis using Anti-NID2 antibody NBP2-55427 (A) shows similar pattern to independent antibody NBP2-49045 (B).

Applications for Nidogen-2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Nidogen-2

Basement membranes, which are composed of type IV collagens (see MIM 120130), laminins (see LAMC1; MIM 150290), perlecan (HSPG2; MIM 142461), and nidogen (see NID1; MIM 131390), are thin pericellular protein matrices that control a large number of cellular activities, including adhesion, migration, differentiation, gene expression, and apoptosis.[supplied by OMIM]

Alternate Names

NID2, Nidogen2, Osteonidogen

Gene Symbol

NID2

Additional Nidogen-2 Products

Product Documents for Nidogen-2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Nidogen-2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Nidogen-2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Nidogen-2 Antibody - BSA Free and earn rewards!

Have you used Nidogen-2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies