NOL1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92192

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Human

Applications

Validated:

Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KLMDLFPLSELVEFLEANEVPRPVTLRTNTLKTRRRDLAQALINRGVNLDPLGKWSKTGLVVYDSSVPIGATPEYLAGH

Marker

Nucleolar Marker

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

89 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for NOL1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: NOL1 Antibody [NBP1-92192]

Immunocytochemistry/ Immunofluorescence: NOL1 Antibody [NBP1-92192]

Immunocytochemistry/Immunofluorescence: NOL1 Antibody [NBP1-92192] - Staining of human cell line A-431 shows localization to nucleoli. Antibody staining is shown in green.
Western Blot: NOL1 Antibody [NBP1-92192]

Western Blot: NOL1 Antibody [NBP1-92192]

Western Blot: NOL1 Antibody [NBP1-92192] - Analysis in human cell line NTERA-2.
NOL1 Antibody - BSA Free Immunohistochemistry: NOL1 Antibody - BSA Free [NBP1-92192]

Immunohistochemistry: NOL1 Antibody - BSA Free [NBP1-92192]

Staining of human kidney shows moderate positivity in nucleoli in cells in tubules.
NOL1 Antibody - BSA Free Immunohistochemistry: NOL1 Antibody - BSA Free [NBP1-92192]

Immunohistochemistry: NOL1 Antibody - BSA Free [NBP1-92192]

Staining of human pancreas shows strong positivity in nucleoli in exocrine glandular cells.
NOL1 Antibody - BSA Free Immunohistochemistry: NOL1 Antibody - BSA Free [NBP1-92192]

Immunohistochemistry: NOL1 Antibody - BSA Free [NBP1-92192]

Staining of human skin shows strong positivity in nucleoli in squamous epithelial cells.
NOL1 Antibody - BSA Free Western Blot: NOL1 Antibody - BSA Free [NBP1-92192]

Western Blot: NOL1 Antibody - BSA Free [NBP1-92192]

Analysis in human cell line NTERA-2.
NOL1 Antibody - BSA Free Western Blot: NOL1 Antibody - BSA Free [NBP1-92192]

Western Blot: NOL1 Antibody - BSA Free [NBP1-92192]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Applications for NOL1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NOL1

Nucleolar protein 1 (NOL1) is a protein highly expressed in proliferating cells; it is expressed in G1 and peaks during early S phase. It is proposed to play a role in the regulation of the cell cycle, and it may function as a ribosomal RNA methyltransferase. Alternative names for NOL1 include p120 nucleolar-proliferation antigen, nucleolar protein 2 homolog, proliferating-cell nucleolar antigen p120, proliferation-associated nucleolar protein p120, NSUN1, and NOP2.

Alternate Names

EC 2.1.1, EC 2.1.1.-, MGC149287, MGC149288, NOL1/NOP2/Sun domain family, member 1, NOL1MGC117384, NOP120, NOP2 nucleolar protein homolog (yeast), NOP2/Sun domain family, member 1, NSUN1, Nucleolar protein 1, nucleolar protein 1 (120kD), nucleolar protein 1, 120kDa, Nucleolar protein 2 homolog, nucleolar protein 2 homolog (yeast), p120, Proliferating-cell nucleolar antigen p120, Proliferation-associated nucleolar protein p120, putative ribosomal RNA methyltransferase NOP2

Entrez Gene IDs

4839 (Human); 110109 (Mouse)

Gene Symbol

NOP2

UniProt

Additional NOL1 Products

Product Documents for NOL1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NOL1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for NOL1 Antibody - BSA Free

Customer Reviews for NOL1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NOL1 Antibody - BSA Free and earn rewards!

Have you used NOL1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...