NONO Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38716

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (99%), Rat (97%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NONO Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: EEMRRQQEEMMRRQQEGFKGTFPDAREQEIRMGQMAMGGAMGINNRGAMPPAPVPAGTPAPPGPATMMPDGTLG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NONO Antibody - BSA Free

Western Blot: NONO Antibody [NBP2-38716]

Western Blot: NONO Antibody [NBP2-38716]

Western Blot: NONO Antibody [NBP2-38716] - Analysis using Anti-NONO antibody NBP2-38716 (A) shows similar pattern to independent antibody NBP2-38727 (B).
Immunocytochemistry/ Immunofluorescence: NONO Antibody [NBP2-38716]

Immunocytochemistry/ Immunofluorescence: NONO Antibody [NBP2-38716]

Immunocytochemistry/Immunofluorescence: NONO Antibody [NBP2-38716] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: NONO Antibody [NBP2-38716]

Immunohistochemistry-Paraffin: NONO Antibody [NBP2-38716]

Immunohistochemistry-Paraffin: NONO Antibody [NBP2-38716] - Staining of human kidney.
Immunohistochemistry: NONO Antibody [NBP2-38716]

Immunohistochemistry: NONO Antibody [NBP2-38716]

Immunohistochemistry: NONO Antibody [NBP2-38716] - Staining of human heart muscle shows strong nuclear positivity in myocytes.
Immunohistochemistry-Paraffin: NONO Antibody [NBP2-38716]

Immunohistochemistry-Paraffin: NONO Antibody [NBP2-38716]

Immunohistochemistry-Paraffin: NONO Antibody [NBP2-38716] - Staining of human colon, kidney, liver and testis using Anti-NONO antibody NBP2-38716 (A) shows similar protein distribution across tissues to independent antibody NBP2-38727 (B).
Immunohistochemistry-Paraffin: NONO Antibody [NBP2-38716]

Immunohistochemistry-Paraffin: NONO Antibody [NBP2-38716]

Immunohistochemistry-Paraffin: NONO Antibody [NBP2-38716] - Staining of human colon.
Immunohistochemistry-Paraffin: NONO Antibody [NBP2-38716]

Immunohistochemistry-Paraffin: NONO Antibody [NBP2-38716]

Immunohistochemistry-Paraffin: NONO Antibody [NBP2-38716] - Staining of human liver.
Immunohistochemistry-Paraffin: NONO Antibody [NBP2-38716]

Immunohistochemistry-Paraffin: NONO Antibody [NBP2-38716]

Immunohistochemistry-Paraffin: NONO Antibody [NBP2-38716] - Staining of human testis.

Applications for NONO Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NONO

Non-POU-domain-containing octamer binding protein (NONO) is a member of the DBHS (drosophila behavior, human splicing) domain-containing family and is an RNA- and DNA- binding protein. NONO and other DBHS domain-containing proteins are multifunctional and are reported to be involved in transcriptional regulation, mRNA processing, and DNA non-homologous end joining (NHEJ). NONO functions as a coregulator of the androgen receptor (AR) and also regulates cAMP transcriptional activity by interacting with gene promoter elements. NONO is also involved in pre-mRNA splicing through an interaction with U5 snRNA and can stimulate DNA nonhomologous end joining (NHEJ) through the interaction with ku70/G22p and ku80/XRCC5 dimers. Alternate names for NONO include 54 kDa nuclear RNA- and DNA-binding protein, p54 (nrb), 55 kDa nuclear protein, NMT55, DNA-binding p52/p100 complex, NRB54, P54, and P54NRB.

Alternate Names

NMT5552 kDa subunit, non-POU domain containing, octamer-binding, NRB54non-POU-domain-containing, octamer-binding, p54(nrb)

Gene Symbol

NONO

UniProt

Q15233 (Human)

Additional NONO Products

Product Documents for NONO Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NONO Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NONO Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NONO Antibody - BSA Free and earn rewards!

Have you used NONO Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies