NORE1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57516

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NORE1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EGLSRDRPSPESTLTVTFSQNVCKPVEETQRPPTLQEIKQKIDSYNTREKNCLGMKLSEDGTY

Reactivity Notes

Rat 81%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NORE1 Antibody - BSA Free

Western Blot: NORE1 Antibody [NBP2-57516]

Western Blot: NORE1 Antibody [NBP2-57516]

Western Blot: NORE1 Antibody [NBP2-57516] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunohistochemistry-Paraffin: NORE1 Antibody [NBP2-57516]

Immunohistochemistry-Paraffin: NORE1 Antibody [NBP2-57516]

Immunohistochemistry-Paraffin: NORE1 Antibody [NBP2-57516] - Immunohistochemical staining of human spleen shows strong cytoplasmic positivity in cells in red pulp and white pulp.

Applications for NORE1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NORE1

NORE1 (also referred to as Ras Association (RalGDS/AF-6) Domain Family Member 5) is a tumor suppressor and induces apoptosis. NORE1 is known to have interactions with HIST1H4A, HIST1H4B, HIST1H4C, HIST1H4D and HIST1H4E. NORE1 has been studied in relation to several types of cancer including lung cancer, breast cancer, clear cell renal cell carcinoma, thyroid carcinoma, and follicular thyroid carcinoma.

Alternate Names

Maxp1, MGC10823, MGC17344, New ras effector 1, NORE1A, NORE1B, NORE1RASSF3, Rap1-binding protein, RAPLnovel Ras effector 1, Ras association (RalGDS/AF-6) domain family 5, Ras association (RalGDS/AF-6) domain family member 5, ras association domain-containing protein 5, Ras effector-like protein, regulator for cell adhesion and polarization enriched in lymphoid tissue, Regulator for cell adhesion and polarization enriched in lymphoid tissues, tumor suppressor RASSF3

Gene Symbol

RASSF5

Additional NORE1 Products

Product Documents for NORE1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NORE1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NORE1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NORE1 Antibody - BSA Free and earn rewards!

Have you used NORE1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies