NRAS Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38443

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 90-189 of human NRAS (NP_002515.1).

Sequence:
FADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for NRAS Antibody - BSA Free

NRAS Antibody

Western Blot: NRAS Antibody [NBP3-38443] -

Western Blot: NRAS Antibody [NBP3-38443] - Western blot analysis of lysates from Mouse brain, using NRAS Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
NRAS Antibody

Immunocytochemistry/ Immunofluorescence: NRAS Antibody [NBP3-38443] -

Immunocytochemistry/ Immunofluorescence: NRAS Antibody [NBP3-38443] - Immunofluorescence analysis of C6 cells using NRAS Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
NRAS Antibody

Immunocytochemistry/ Immunofluorescence: NRAS Antibody [NBP3-38443] -

Immunocytochemistry/ Immunofluorescence: NRAS Antibody [NBP3-38443] - Immunofluorescence analysis of U2OS cells using NRAS Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
NRAS Antibody

Immunocytochemistry/ Immunofluorescence: NRAS Antibody [NBP3-38443] -

Immunocytochemistry/ Immunofluorescence: NRAS Antibody [NBP3-38443] - Immunofluorescence analysis of NIH/3T3 cells using NRAS Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
NRAS Antibody

Western Blot: NRAS Antibody [NBP3-38443] -

Western Blot: NRAS Antibody [NBP3-38443] - Western blot analysis of various lysates using NRAS Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 10s.

Applications for NRAS Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: NRAS

Ras (p21), a signal transducer, was first characterized as the transforming genes of Harvey & Kristen sarcoma virus (1). The Ras family (H-Ras, N-Ras, and K-Ras) regulates cell growth, differentiation and apoptosis (2). Switching from an active or resting state, Ras can either bind GTP or GDP respectively. In the triphosphate conformation, Ras will interact with GTPase activating protein (GAP) to increase its activity (3). Mutations in any of the three isoforms can convert these proteins into active oncogenes. Additionally, Ras mutations are found in 30% of all human cancer (4).

Alternate Names

ALPS4, GTPase NRas, HRAS1, neuroblastoma RAS viral (v-ras) oncogene homolog, N-ras, N-ras protein part 4, NRAS1, NS6, Transforming protein N-Ras, v-ras neuroblastoma RAS viral oncogene homolog

Gene Symbol

NRAS

Additional NRAS Products

Product Documents for NRAS Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NRAS Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NRAS Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NRAS Antibody - BSA Free and earn rewards!

Have you used NRAS Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...