NRBF2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38273

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NRBF2 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-287 of human NRBF2 (NP_110386.2).

Sequence:
MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERLKAQQNTDKDAAAHLQTSHKPSAEDAEGQSPLSQKYSPSTEKCLPEIQGIFDRDPDTLLYLLQQKSEPAEPCIGSKAPKDDKTIIEEQATKIADLKRHVEFLVAENERLRKENKQLKAEKARLLKGPIEKELDVDADFVETSELWSLPPHAETATASSTWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDILKGFMNN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for NRBF2 Antibody - BSA Free

NRBF2 Antibody

Western Blot: NRBF2 Antibody [NBP3-38273] -

Western Blot: NRBF2 Antibody [NBP3-38273] - Western blot analysis of lysates from HepG2 cells, using [KO Validated] NRBF2 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 3min.
NRBF2 Antibody

Western Blot: NRBF2 Antibody [NBP3-38273] -

Western Blot: NRBF2 Antibody [NBP3-38273] - Western blot analysis of various lysates using NRBF2 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 90s.
NRBF2 Antibody

Immunocytochemistry/ Immunofluorescence: NRBF2 Antibody [NBP3-38273] -

Immunocytochemistry/ Immunofluorescence: NRBF2 Antibody [NBP3-38273] - Immunofluorescence analysis of L929 cells using [KO Validated] NRBF2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
NRBF2 Antibody

Immunocytochemistry/ Immunofluorescence: NRBF2 Antibody [NBP3-38273] -

Immunocytochemistry/ Immunofluorescence: NRBF2 Antibody [NBP3-38273] - Immunofluorescence analysis of C6 cells using [KO Validated] NRBF2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
NRBF2 Antibody

Immunocytochemistry/ Immunofluorescence: NRBF2 Antibody [NBP3-38273] -

Immunocytochemistry/ Immunofluorescence: NRBF2 Antibody [NBP3-38273] - Immunofluorescence analysis of C6 cells using NRBF2 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
NRBF2 Antibody

Immunocytochemistry/ Immunofluorescence: NRBF2 Antibody [NBP3-38273] -

Immunocytochemistry/ Immunofluorescence: NRBF2 Antibody [NBP3-38273] - Immunofluorescence analysis of HeLa cells using NRBF2 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
NRBF2 Antibody

Immunohistochemistry: NRBF2 Antibody [NBP3-38273] -

Immunohistochemistry: NRBF2 Antibody [NBP3-38273] - Immunohistochemistry analysis of paraffin-embedded Human esophageal using [KO Validated] NRBF2 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
NRBF2 Antibody

Immunocytochemistry/ Immunofluorescence: NRBF2 Antibody [NBP3-38273] -

Immunocytochemistry/ Immunofluorescence: NRBF2 Antibody [NBP3-38273] - Immunofluorescence analysis of C6 cells using NRBF2 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
NRBF2 Antibody

Immunohistochemistry: NRBF2 Antibody [NBP3-38273] -

Immunohistochemistry: NRBF2 Antibody [NBP3-38273] - Immunohistochemistry analysis of paraffin-embedded Human esophageal using [KO Validated] NRBF2 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
NRBF2 Antibody

Western Blot: NRBF2 Antibody [NBP3-38273] -

Western Blot: NRBF2 Antibody [NBP3-38273] - Western Blot analysis of various lysates using NRBF2 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

Applications for NRBF2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: NRBF2

NRBF2 (nuclear receptor binding factor-2) was originally identified in a yeast two-hybrid screen for factors that interact with the peroxisome proliferator-activated receptor alpha (PPARalpha). In a second study, NRBF2 was also identified in a screen of a keratinocyte cDNA library and named COPR (comodulator of PPAR and RXR). In this study, NRBF2 was proposed to function as a modulator of transcriptional activity that functions to decrease rather than completely repress nuclear-receptor mediated gene expression. Alternative names for NRBF2 include COPR1, COPR2, and NRBF-2.

Alternate Names

Comodulator of PPAR and RXR, COPR, COPR1, COPR2, DKFZp564C1664, FLJ30395, NRBF-2, nuclear receptor binding factor 2, nuclear receptor binding factor-2, nuclear receptor-binding factor 2

Gene Symbol

NRBF2

Additional NRBF2 Products

Product Documents for NRBF2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NRBF2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NRBF2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NRBF2 Antibody - BSA Free and earn rewards!

Have you used NRBF2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies