NS1-BP Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85403

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all NS1-BP Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human NS1-BP. Peptide sequence: MIPNGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for NS1-BP Antibody - BSA Free

Western Blot: NS1-BP Antibody [NBP2-85403]

Western Blot: NS1-BP Antibody [NBP2-85403]

Western Blot: NS1-BP Antibody [NBP2-85403] - WB Suggested Anti-IVNS1ABP Antibody Titration: 2.0ug/ml. Positive Control: HepG2 cell lysate
Immunohistochemistry: NS1-BP Antibody [NBP2-85403]

Immunohistochemistry: NS1-BP Antibody [NBP2-85403]

Immunohistochemistry: NS1-BP Antibody [NBP2-85403] - Human Stomach

Applications for NS1-BP Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NS1-BP

IVNS1ABP plays a role in cell division and in the dynamic organization of the actin skeleton as a stabilizer of actin filaments by association with F-actin through Kelch repeats. Protects cells from cell death induced by actin destabilization; Protects neurons fro

Alternate Names

ARA3, aryl hydrocarbon receptor-associated 3, Aryl hydrocarbon receptor-associated protein 3, DKFZp686K06216, FLARA3, FLJ10962, FLJ35593, FLJ36593, HSPC068, influenza virus NS1A binding protein, influenza virus NS1A-binding protein, KIAA0850FLJ10069, KLHL39, NCX downstream gene 1, ND1, NS1, NS-1, NS1-binding protein, NS1BP, NS1-BPFLJ10411

Gene Symbol

IVNS1ABP

Additional NS1-BP Products

Product Documents for NS1-BP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NS1-BP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NS1-BP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NS1-BP Antibody - BSA Free and earn rewards!

Have you used NS1-BP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies