NUP37 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55454

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NUP37 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YPQNKRPVHMDRACLFRWSTISENLFATTGYPGKMASQFQIHHLGHPQPILMGSVAVGSGLSWHRTLPLCVIGGDHKLLFWVTEV

Reactivity Notes

Mouse (88%), Rat (86%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NUP37 Antibody - BSA Free

Western Blot: NUP37 Antibody [NBP2-55454]

Western Blot: NUP37 Antibody [NBP2-55454]

Western Blot: NUP37 Antibody [NBP2-55454] - Analysis using Anti-NUP37 antibody NBP2-55454 (A) shows similar pattern to independent antibody NBP2-58005 (B).
Western Blot: NUP37 Antibody [NBP2-55454]

Western Blot: NUP37 Antibody [NBP2-55454]

Western Blot: NUP37 Antibody [NBP2-55454] - Analysis in human cell line BEWO.
Immunocytochemistry/ Immunofluorescence: NUP37 Antibody [NBP2-55454]

Immunocytochemistry/ Immunofluorescence: NUP37 Antibody [NBP2-55454]

Immunocytochemistry/Immunofluorescence: NUP37 Antibody [NBP2-55454] - Staining of human cell line U-251 MG shows localization to nucleoplasm.

Applications for NUP37 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NUP37

Bidirectional transport of macromolecules between the cytoplasm and nucleus occurs through nuclear pore complexes(NPCs) embedded in the nuclear envelope. NPCs are composed of subcomplexes, and NUP37 is part of one such subcomplex,Nup107-160 (Loiodice et al., 2004 (PubMed 15146057)).(supplied by OMIM)

Alternate Names

MGC5585, nucleoporin 37kDa, nucleoporin Nup37, Nup107-160 subcomplex subunit Nup37, p37FLJ22618

Gene Symbol

NUP37

Additional NUP37 Products

Product Documents for NUP37 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NUP37 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NUP37 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NUP37 Antibody - BSA Free and earn rewards!

Have you used NUP37 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies