NXF1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57160

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to NXF1 (nuclear RNA export factor 1) The peptide sequence was selected from the N terminal of NXF1. Peptide sequence MADEGKSYSEHDDERVNFPQRKKKGRGPFRWKYGEGNRRSGRGGSGIRSS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for NXF1 Antibody - BSA Free

Western Blot: NXF1 Antibody [NBP1-57160]

Western Blot: NXF1 Antibody [NBP1-57160]

Western Blot: NXF1 Antibody [NBP1-57160] - Lanes: Lane 1 : 7ug HeLa lysate +EGFP SiRNA Lane 2: 7ug HeLa lysate +NXF1 SiRNA Primary, Antibody Dilution: 1 : 300 Secondary Antibody: Anti-rabbit-HRP Secondary, Antibody Dilution: 1 : 500 Gene name: NXF1.
Immunohistochemistry-Paraffin: NXF1 Antibody [NBP1-57160]

Immunohistochemistry-Paraffin: NXF1 Antibody [NBP1-57160]

Immunohistochemistry-Paraffin: NXF1 Antibody [NBP1-57160] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
Western Blot: NXF1 Antibody [NBP1-57160]

Western Blot: NXF1 Antibody [NBP1-57160]

Western Blot: NXF1 Antibody [NBP1-57160] - HepG2 cell lysate, Antibody Titration: 1.25ug/ml

Applications for NXF1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NXF1

NXF1 is one member of a family of nuclear RNA export factor. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity. NXF1 shuttles between the nucleus and the cytoplasm and binds in vivo to poly(A)+ RNA. NXF1 overcomes the mRNA export block caused by the presence of saturating amounts of CTE (constitutive transport element) RNA of type D retroviruses.This gene is one member of a family of nuclear RNA export factor genes. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity. Alternative splicing seems to be a common mechanism in this gene family. The encoded protein of this gene shuttles between the nucleus and the cytoplasm and binds in vivo to poly(A)+ RNA. It is the vertebrate homologue of the yeast protein Mex67p. The encoded protein overcomes the mRNA export block caused by the presence of saturating amounts of CTE (constitutive transport element) RNA of type D retroviruses.

Alternate Names

DKFZp667O0311, Mex67, mRNA export factor TAP, nuclear RNA export factor 1, TAPMEX67, tip associating protein, Tip-associated protein, Tip-associating protein

Gene Symbol

NXF1

UniProt

Additional NXF1 Products

Product Documents for NXF1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NXF1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NXF1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NXF1 Antibody - BSA Free and earn rewards!

Have you used NXF1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...