OAS1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-58950

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all OAS1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to OAS1(2',5'-oligoadenylate synthetase 1, 40/46kDa) The peptide sequence was selected from the C terminal of OAS1. Peptide sequence GWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLVRPPASSLPFIPAPLHEA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for OAS1 Antibody - BSA Free

Western Blot: OAS1 Antibody [NBP1-58950]

Western Blot: OAS1 Antibody [NBP1-58950]

Western Blot: OAS1 Antibody [NBP1-58950] - OAS1 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human heart
Immunohistochemistry-Paraffin: OAS1 Antibody [NBP1-58950]

Immunohistochemistry-Paraffin: OAS1 Antibody [NBP1-58950]

Immunohistochemistry-Paraffin: OAS1 Antibody [NBP1-58950] - Human tonsil tissue 5ug/ml

Applications for OAS1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: OAS1

OAS1 is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. It is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. Mutations in this gene have been associated with host susceptibility to viral infection.This gene encodes a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. The encoded protein is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. The three known members of this gene family are located in a cluster on chromosome 12. Mutations in this gene have been associated with host susceptibility to viral infection. Alternatively spliced transcript variants encoding different isoforms have been described.

Alternate Names

(2-5')oligo(A) synthase 1,2'-5'-oligoadenylate synthetase 1,2-5A synthase 1,2'-5'-oligoisoadenylate synthetase 1, (2-5')oligo(A) synthetase 1, 2'-5'-oligo A synthetase 1, 2'-5'-oligoadenylate synthase 1, 2'-5'-oligoadenylate synthetase 1 (40-46 kD), 2'-5'-oligoadenylate synthetase 1, 40/46kDa, E18/E16,2-5A synthetase 1, EC 2.7.7, EC 2.7.7.-, IFI-4,2'-5' oligoadenylate synthetase 1 p52 isoform, OIAS2'-5' oligoadenylate synthetase 1 p48 isoform, OIASI, p46/p42 OAS

Gene Symbol

OAS1

UniProt

P00973-2 (Human)

Additional OAS1 Products

Product Documents for OAS1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for OAS1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for OAS1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review OAS1 Antibody - BSA Free and earn rewards!

Have you used OAS1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies