Occludin Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-87402
Loading...
Key Product Details
Validated by
Knockout/Knockdown, Orthogonal Validation, Biological Validation
Species Reactivity
Validated:
Human, Mouse, Rat
Cited:
Human, Mouse, Rat
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Knockdown Validated
Cited:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, IF/IHC
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DKEHIYDEQPPNVEEWVKNVSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEVVQELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEED
Reactivity Notes
Rat reactivity reported in scientific literature (PMID: 31715313). Mouse reactivity reported in (PMID: 30685438), and a verified customer review.
Marker
Tight Junctions Marker
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
Novus Biologicals Rabbit Occludin Antibody - BSA Free (NBP1-87402) is a polyclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. Anti-Occludin Antibody: Cited in 23 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for Occludin Antibody - BSA Free
Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402]
Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402] - Staining of human prostate shows negative membranous positivity in glandular cells as expected.Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402]
Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402] - Staining of human breast cancer shows moderate membranous positivity in tumor cells.Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402]
Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402] - Staining of human prostate cancer shows moderate membranous positivity in tumor cells.Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402]
Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402] - Staining of human stomach shows moderate membranous positivity in glandular cells.Applications for Occludin Antibody - BSA Free
Application
Recommended Usage
ELISA
Validated from a verified customer review
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Western Blot
0.04 - 0.4 ug/mL
Application Notes
Reviews and literature that use this antibody in ICC/IF are from a previous lot. This antibody is not suitable for ICC/IF usage. For IHC-Paraffin, HIER pH 6 retrieval is recommended
Reviewed Applications
Read 4 reviews rated 4 using NBP1-87402 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Occludin
Alternate Names
BLCPMG, OCLN
Gene Symbol
OCLN
Additional Occludin Products
Product Documents for Occludin Antibody - BSA Free
Product Specific Notices for Occludin Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for Occludin Antibody - BSA Free
Customer Reviews for Occludin Antibody - BSA Free (4)
4 out of 5
4 Customer Ratings
Have you used Occludin Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
4 of
4 reviews
Showing All
Filter By:
-
Application: ImmunocytochemistrySample Tested: IEC-6 rat intestinal epithelial cellsSpecies: RatVerified Customer | Posted 04/06/2022Occludin expression in IEC-6 cells
-
Application: ELISASample Tested: rat intestineSpecies: RatVerified Customer | Posted 06/01/2021Occludin levels in untreated and LPS treated rat intestinal tissues.
-
Application: Western BlotSample Tested: Primary lung endothelial cellsSpecies: MouseVerified Customer | Posted 06/15/2017Lane 1: untreated vascular endothelial cells Lane 2: vascular endothelial cells + control siRNAMembrane was blocked in 5% milk in TBST. Primary antibody dilution was 1:1000 and the dilution for the secondary ab was 1:5000.
-
Application: ImmunofluorescenceSample Tested: Mouse choroid plexus cellsSpecies: MouseVerified Customer | Posted 04/06/2015Occludin staining in murine choroid plexus cells at 1:50 dilution (Methanol fixation)
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...