Occludin Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87402

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown, Orthogonal Validation

Species Reactivity

Validated:

Human

Cited:

Human, Mouse, Rat

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Knockdown Validated

Cited:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: DKEHIYDEQPPNVEEWVKNVSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEVVQELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEED

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 31715313). Mouse reactivity reported in (PMID: 30685438), and a verified customer review.

Marker

Tight Junctions Marker

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Occludin Antibody - BSA Free

Western Blot: Occludin Antibody [NBP1-87402]

Western Blot: Occludin Antibody [NBP1-87402]

Western Blot: Occludin Antibody [NBP1-87402] - Analysis in human cell line CACO-2 and human cell line HeLa.
Western Blot: Occludin Antibody [NBP1-87402]

Western Blot: Occludin Antibody [NBP1-87402]

Western Blot: Occludin Antibody [NBP1-87402] - Lane 1: untreated vascular endothelial cells Lane 2: vascular endothelial cells + control siRNA. Primary antibody was diluted 1:1000. WB image submitted by a verified customer review.
Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402]

Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402]

Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402] - Staining of human prostate shows negative membranous positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402]

Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402]

Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402] - Staining of human breast cancer shows moderate membranous positivity in tumor cells.
Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402]

Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402]

Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402] - Staining of human prostate cancer shows moderate membranous positivity in tumor cells.
Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402]

Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402]

Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402] - Staining of human stomach shows moderate membranous positivity in glandular cells.
Occludin Antibody - BSA Free

Western Blot: Occludin Antibody - BSA Free [NBP1-87402] -

KD improved vascular hyperpermeability and reduced vascular stiffness and leakage in type 2 diabetic mice. (A, B) The Evans blue injection and haematoxylin and eosin staining of abdominal aorta were performed for different groups, original magnification, ×10 (haematoxylin and eosin staining). Scale bar, 50 μm (haematoxylin and eosin staining). (C–H) The protein levels of vascular PES1, VEGF, VE‐cadherin, Ang‐1 and Occludin were detected by Immunoblotting. Data are represented as mean +/- SEM, each assay was performed independently three times (n = 12 per group). KD (ketogenic diet), SD (standard diet). **p < 0.01 C57BL/6J‐KD versus C57BL/6J‐SD, ***p < 0.001 C57BL/6J‐KD versus C57BL/6J‐SD, #p < 0.05 db/db‐KD versus db/db‐SD, ##p < 0.01 db/db‐KD versus db/db‐SD, ###p < 0.001 db/db‐KD versus db/db‐SD, +p < 0.05 C57BL/J‐SD versus db/db‐SD, ++p < 0.01 C57BL/J‐SD versus db/db‐SD, +++p < 0.001 C57BL/J‐SD versus db/db‐SD, &&p < 0.01 C57BL/6J‐KD versus db/db‐KD, &&&p < 0.001 C57BL/6J‐KD versus db/db‐KD (anova, Student–Newman–Keuls q‐test). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37060584), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Occludin Antibody - BSA Free

Western Blot: Occludin Antibody - BSA Free [NBP1-87402] -

Pes1 knockout in mice decreased vascular permeability. (A, B) The Evans blue injection and haematoxylin and eosin staining of abdominal aorta were conducted in different groups, original magnification, ×10 (haematoxylin and eosin staining). Scale bar, 50 μm (haematoxylin and eosin staining). (C–F) The protein levels of vascular PES1, VEGF, VE‐cadherin, Ang‐1 and Occludin were measured by Immunoblotting. Data were represented as mean +/- SEM, each assay was performed independently three times. **p < 0.01, ***p < 0.001 compared with control (Student's t‐test). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37060584), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Occludin Antibody - BSA Free

Western Blot: Occludin Antibody - BSA Free [NBP1-87402] -

beta ‐HB treatment impaired the increment of paracellular permeability by in vitro supplementation of Pes1. (A, B) The protein levels of PES1, VEGF, VE‐cadherin, Ang‐1 and Occludin in MVECs were detected by immunoblotting after Flag‐Pes1 plus beta ‐HB treatment. (C, D) Shown are immunofluorescence images of Flag‐Pes1 plus beta ‐HB‐treated MVECs for Occludin and VE‐cadherin expression and localizations, scale bar represents 20 μm. The nuclei were stained with DAPI. (E) Exhibited is the paracellular permeability in the cultured MVECs in different groups. Data were represented as mean +/- SEM, each experiment was performed independently three times. **p < 0.01, ***p < 0.001 compared with control (anova, Student–Newman–Keuls q‐test). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37060584), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Occludin Antibody - BSA Free

Western Blot: Occludin Antibody - BSA Free [NBP1-87402] -

beta ‐HB treatment reduced vascular endothelial paracellular permeability in vitro. (A, B) The protein levels of PES1, VEGF, VE‐cadherin, Ang‐1 and Occludin in MVECs were detected by immunoblotting after 2 mM beta ‐HB treatment for 24 h. (C–H) Displayed are immunofluorescence images of beta ‐HB‐treated MVECs for VE‐cadherin, VEGF and PES1 expression and localizations, scale bar represents 20 μm. The nuclei were stained with DAPI. (I) Exhibited is the paracellular permeability in the cultured MVECs under different treatments. Ctrl (Control), beta ‐HB ( beta ‐hydroxybutyric acid). Data were represented as mean +/- SEM, each experiment was performed independently three times. **p < 0.01, ***p < 0.001 compared with control (Student's t‐test). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37060584), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Occludin Antibody - BSA Free

Western Blot: Occludin Antibody - BSA Free [NBP1-87402] -

PLX3397 reduces tight junction expressionA, BWestern blot of lysates from PLX3397 treated b.End3 cells for tight junction proteins ZO‐1, Occludin and Claudin‐5 (A). The horizontal line indicates untreated cells, with increasing PLX3397 concentrations (5, 10, 20 μM). Corresponding densitometry is given in (B). (One‐way ANOVA with Dunnett’s post‐test for multiple comparisons, *P < 0.05, **P < 0.005, ***P < 0.0005, n = 3 independent experiments, error bars indicate SEM)CGene expression changes at 24 (top) and 48 (bottom) h in PLX3397 treated b.End3 cells shown by qPCR for Tjp1, Ocln and Cldn5 (*P < 0.05, **P < 0.006, n = 3 independent experiments one‐way ANOVA with Dunnett’s post‐test, error bars indicate SEM).DqPCR analysis of tight junction and CSF‐1R pathway gene expression changes at 24 h in PLX3397 treated MBECs (one‐way ANOVA with Dunnett’s post‐test for multiple comparisons, **P < 0.009, n = 3 independent experiments, error bars indicate SEM).EFITC‐4kDA transwell permeability assay of primary mouse microvascular endothelial cells (MBECs) treated for 24 h with PLX3397 at indicated doses (one‐way ANOVA with Dunnett’s correction, n = 3 technical replicates for flux assay, one‐way ANOVA with Dunnett’s post‐test for multiple comparisons, **P = 0.0012, error bars indicate SEM). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/33350588), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Occludin Antibody - BSA Free

Western Blot: Occludin Antibody - BSA Free [NBP1-87402] -

In vitro knockdown of Pes1 lowered the paracellular permeability of MVECs. (A, B) The protein levels of PES1, VEGF, VE‐cadherin, Ang‐1 and Occludin in MVECs were detected by immunoblotting after Pes1‐siRNA treatment. (C, D) Shown are immunofluorescence images of Pes1‐siRNA‐treated MVECs for Occludin and VE‐cadherin expression and localizations, scale bar represents 20 μm. The nuclei were stained with DAPI. (E) Exhibited is the paracellular permeability in the cultured MVECs in different groups. Data were represented as mean +/- SEM, each experiment was performed independently three times. **p < 0.01, ***p < 0.001 compared with control (Student's t‐test). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37060584), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for Occludin Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04 - 0.4 ug/mL
Application Notes
Reviews and literature that use this antibody in ICC/IF are from a previous lot. This antibody is not suitable for ICC/IF usage. IHC-Paraffin, HIER pH 6 retrieval is recommended

Reviewed Applications

Read 4 reviews rated 4 using NBP1-87402 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Occludin

The Occludin gene encodes an integral membrane protein which is located at tight junctions. This protein may be involved in the formation and maintenance of the tight junction.

Alternate Names

BLCPMG, OCLN

Gene Symbol

OCLN

Additional Occludin Products

Product Documents for Occludin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Occludin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Occludin Antibody - BSA Free

Customer Reviews for Occludin Antibody - BSA Free (4)

4 out of 5
4 Customer Ratings
5 Stars
25%
4 Stars
50%
3 Stars
25%
2 Stars
0%
1 Stars
0%

Have you used Occludin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 4 of 4 reviews Showing All
Filter By:
  • Occludin Antibody
    Name: Russ Tas
    Application: Immunocytochemistry
    Sample Tested: IEC-6 rat intestinal epithelial cells
    Species: Rat
    Verified Customer | Posted 04/06/2022
    Occludin expression in IEC-6 cells
    Occludin Antibody - BSA Free NBP1-87402
  • Occludin Antibody
    Name: Anonymous
    Application: ELISA
    Sample Tested: rat intestine
    Species: Rat
    Verified Customer | Posted 06/01/2021
    Occludin levels in untreated and LPS treated rat intestinal tissues.
    Occludin Antibody - BSA Free NBP1-87402
  • Occludin Antibody
    Name: James Xiao
    Application: Western Blot
    Sample Tested: Primary lung endothelial cells
    Species: Mouse
    Verified Customer | Posted 06/15/2017
    Lane 1: untreated vascular endothelial cells Lane 2: vascular endothelial cells + control siRNA
    Membrane was blocked in 5% milk in TBST. Primary antibody dilution was 1:1000 and the dilution for the secondary ab was 1:5000.
    Occludin Antibody - BSA Free NBP1-87402
  • Name: Anonymous
    Application: Immunofluorescence
    Sample Tested: Mouse choroid plexus cells
    Species: Mouse
    Verified Customer | Posted 04/06/2015
    Occludin staining in murine choroid plexus cells at 1:50 dilution (Methanol fixation)
    Occludin Antibody - BSA Free NBP1-87402

There are no reviews that match your criteria.

Showing  1 - 4 of 4 reviews Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies