OMA1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-30971

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all OMA1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: YLDRLIPQALKIREMCNCPPLSNPDPRLLFKLSTKHFLEESEKEDLNITKKQKMDTLPIQKQEQIPLTYIVEKRTGS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for OMA1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: OMA1 Antibody [NBP2-30971]

Immunocytochemistry/ Immunofluorescence: OMA1 Antibody [NBP2-30971]

Immunocytochemistry/Immunofluorescence: OMA1 Antibody [NBP2-30971] - Staining of human cell line U-251 MG shows localization to nucleoplasm & mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: OMA1 Antibody [NBP2-30971]

Immunohistochemistry-Paraffin: OMA1 Antibody [NBP2-30971]

Immunohistochemistry-Paraffin: OMA1 Antibody [NBP2-30971] - Staining of human testis shows moderate granular cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: OMA1 Antibody [NBP2-30971]

Immunohistochemistry-Paraffin: OMA1 Antibody [NBP2-30971]

Immunohistochemistry-Paraffin: OMA1 Antibody [NBP2-30971] - Staining of human colon shows weak to moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: OMA1 Antibody [NBP2-30971]

Immunohistochemistry-Paraffin: OMA1 Antibody [NBP2-30971]

Immunohistochemistry-Paraffin: OMA1 Antibody [NBP2-30971] - Staining of human kidney shows moderate to strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: OMA1 Antibody [NBP2-30971]

Immunohistochemistry-Paraffin: OMA1 Antibody [NBP2-30971]

Immunohistochemistry-Paraffin: OMA1 Antibody [NBP2-30971] - Staining of human lymphoid tissues shows moderate granular cytoplasmic positivity in germinal center cells.

Applications for OMA1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: OMA1

OMA1, also known as Metalloendopeptidase OMA1, mitochondrial, has 2 isoforms, a 524 amino acid long isoform that is 60 kDa and a short 486 amino acid isoform that is 56 kDa; widely expressed, with strong expression in the heart, skeletal muscle, kidney and liver; participates in the quality control system in the inner membrane of mitochondria following stress conditions that induce loss of mitochondrial membrane potential, mediates cleavage of OPA1 at S1 position, leading to OPA1 inactivation and negative regulation of mitochondrial fusion. Its role in mitochondrial quality control is essential for regulating lipid metabolism as well as to maintain body temperature and energy expenditure under cold-stress conditions. Studies are being performed on the relationship of this protein to amyotrophic lateral sclerosis, lateral sclerosis, childhood medulloblastoma, and medulloblastoma. OMA1 protein involvement has been observed with relation to diet induced thermogenesis, glucose metabolic process, misfolded or incompletely synthesized protein catabolic process, lipid metabolic process, negative regulation of mitochondrial fusion, and cristae formation processes.

Alternate Names

2010001O09Rik, DAB1, EC 3.4.24.-, metalloprotease related protein 1, Metalloprotease-related protein 1, MPRP1, MPRP-1mitochondrial, OMA1 homolog, zinc metallopeptidase (S. cerevisiae), overlapping activity with M-AAA protease, YKR087C, ZMPOMA1

Gene Symbol

OMA1

UniProt

Q96E52 (Human)

Additional OMA1 Products

Product Documents for OMA1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for OMA1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for OMA1 Antibody - BSA Free

Customer Reviews for OMA1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review OMA1 Antibody - BSA Free and earn rewards!

Have you used OMA1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies