OR13C9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79985

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all OR13C9 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the middle region of human OR13C9. Peptide sequence IFYGTILFMYMKPKSKETLNSDDLDATDKIISMFYGVMTPMMNPLIYSLR. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for OR13C9 Antibody - BSA Free

Western Blot: OR13C9 Antibody [NBP1-79985]

Western Blot: OR13C9 Antibody [NBP1-79985]

Western Blot: OR13C9 Antibody [NBP1-79985] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
Immunohistochemistry: OR13C9 Antibody [NBP1-79985]

Immunohistochemistry: OR13C9 Antibody [NBP1-79985]

Immunohistochemistry: OR13C9 Antibody [NBP1-79985] - Human Kidney Cellular data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.
Immunohistochemistry: OR13C9 Antibody [NBP1-79985]

Immunohistochemistry: OR13C9 Antibody [NBP1-79985]

Immunohistochemistry: OR13C9 Antibody [NBP1-79985] - Human Brain Cellular data: Neural Cells Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.

Applications for OR13C9 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: OR13C9

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq]

Alternate Names

olfactory receptor, family 13, subfamily C, member 9, OR37L

Gene Symbol

OR13C9

UniProt

NP_001001956 (Human)

Additional OR13C9 Products

Product Documents for OR13C9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for OR13C9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for OR13C9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review OR13C9 Antibody - BSA Free and earn rewards!

Have you used OR13C9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies