OR8S1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92232

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all OR8S1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: ERSLRDSSHLPQLHKGQARWKRPAFTEGRREPGHPELSIPVTPQP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for OR8S1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: OR8S1 Antibody [NBP1-92232]

Immunocytochemistry/ Immunofluorescence: OR8S1 Antibody [NBP1-92232]

Immunocytochemistry/Immunofluorescence: OR8S1 Antibody [NBP1-92232] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane.
Immunohistochemistry-Paraffin: OR8S1 Antibody [NBP1-92232]

Immunohistochemistry-Paraffin: OR8S1 Antibody [NBP1-92232]

Immunohistochemistry-Paraffin: OR8S1 Antibody [NBP1-92232] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Applications for OR8S1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: OR8S1

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers theperception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors(GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with manyneurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction ofodorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to theolfactory receptor genes and proteins for this organism is independent of other organisms. (provided by RefSeq)

Alternate Names

olfactory receptor 8S1, olfactory receptor, family 8, subfamily S, member 1

Gene Symbol

OR8S1

Additional OR8S1 Products

Product Documents for OR8S1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for OR8S1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for OR8S1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review OR8S1 Antibody - BSA Free and earn rewards!

Have you used OR8S1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies