Orc2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56503

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MLEVHFVGDDDVLNHILDREGGAKLKKERAQLLVNPKKIIKKPEYDLEEDDQEVLKDQNYVEIMGRDVQESLKNGSATGGGNKVYSFQNRKHSEKMAK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Orc2 Antibody - BSA Free

Western Blot: Orc2 Antibody [NBP2-56503]

Western Blot: Orc2 Antibody [NBP2-56503]

Western Blot: Orc2 Antibody [NBP2-56503] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: Orc2 Antibody [NBP2-56503]

Immunocytochemistry/ Immunofluorescence: Orc2 Antibody [NBP2-56503]

Immunocytochemistry/Immunofluorescence: Orc2 Antibody [NBP2-56503] - Staining of human cell line Hep G2 shows localization to nucleoplasm.
Orc2 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: Orc2 Antibody - BSA Free [NBP2-56503]

Chromatin Immunoprecipitation-exo-Seq: Orc2 Antibody - BSA Free [NBP2-56503]

ChIP-Exo-Seq composite graph for Anti-ORC2 (NBP2-56503) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for Orc2 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Orc2

The origin recognition complex (ORC) is a highly conserved six subunits protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. The protein encoded by this gene is a subunit of the ORC complex. This protein forms a core complex with ORC3L, -4L, and -5L. It also interacts with CDC45L and MCM10, which are proteins known to be important for the initiation of DNA replication. This protein has been demonstrated to specifically associate with the origin of replication of Epstein-Barr virus in human cells, and is thought to be required for DNA replication from viral origin of replication.

Alternate Names

ORC2Lorigin recognition complex subunit 2, origin recognition complex protein 2 homolog, origin recognition complex, subunit 2, origin recognition complex, subunit 2 (yeast homolog)-like, origin recognition complex, subunit 2 homolog, origin recognition complex, subunit 2 homolog (yeast), origin recognition complex, subunit 2-like, origin recognition complex, subunit 2-like (yeast)

Gene Symbol

ORC2

Additional Orc2 Products

Product Documents for Orc2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Orc2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Orc2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Orc2 Antibody - BSA Free and earn rewards!

Have you used Orc2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...