ORC6L Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57470

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RLCKQLEKIGQQVDREPGDVATPPRKRKKIVVEAPAKEMEKVEEMPHKPQKDEDLTQDYEEWKRKILENAASAQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ORC6L Antibody - BSA Free

Western Blot: ORC6L Antibody [NBP2-57470]

Western Blot: ORC6L Antibody [NBP2-57470]

Western Blot: ORC6L Antibody [NBP2-57470] - Western blot analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: ORC6L Antibody [NBP2-57470]

Immunocytochemistry/ Immunofluorescence: ORC6L Antibody [NBP2-57470]

Immunocytochemistry/Immunofluorescence: ORC6L Antibody [NBP2-57470] - Staining of human cell line PC-3 shows localization to nucleus & nucleoli fibrillar center.
ORC6L Antibody - BSA Free Chromatin Immunoprecipitation ChIP: ORC6L Antibody - BSA Free

Chromatin Immunoprecipitation ChIP: ORC6L Antibody - BSA Free

ChIP-Exo-Seq composite graph for Anti-ORC6L tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.

Applications for ORC6L Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ORC6L

The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. The protein encoded by this gene is a subunit of the ORC complex. It has been shown that this protein and and ORC1L are loosely associated with the core complex consisting of ORC2L, -3L, -4L and -5L. Gene silencing studies with small interfering RNA demonstrated that this protein plays an essential role in coordinating chromosome replication and segregation with cytokinesis.

Alternate Names

ORC6Lorigin recognition complex, subunit 6 homolog-like (yeast), origin recognition complex subunit 6, origin recognition complex, subunit 6, origin recognition complex, subunit 6 like (yeast)

Gene Symbol

ORC6

Additional ORC6L Products

Product Documents for ORC6L Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ORC6L Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ORC6L Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ORC6L Antibody - BSA Free and earn rewards!

Have you used ORC6L Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...