Ornithine Carbamoyltransferase Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54934

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to OTC(ornithine carbamoyltransferase) The peptide sequence was selected from the N terminal of OTC. Peptide sequence AFRNGHNFMVRNFRCGQPLQNKVQLKGRDLLTLKNFTGEEIKYMLWLSAD. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Ornithine Carbamoyltransferase Antibody - BSA Free

Western Blot: Ornithine Carbamoyltransferase Antibody [NBP1-54934]

Western Blot: Ornithine Carbamoyltransferase Antibody [NBP1-54934]

Western Blot: Ornithine Carbamoyltransferase Antibody [NBP1-54934] - Reccomended Titration: 2.5 ug/ml Positive Control: HepG2 cell lysate
Immunohistochemistry: Ornithine Carbamoyltransferase Antibody [NBP1-54934]

Immunohistochemistry: Ornithine Carbamoyltransferase Antibody [NBP1-54934]

Immunohistochemistry: Ornithine Carbamoyltransferase Antibody [NBP1-54934] - Paraffin Embedded Tissue: Human Intestine Cellular Data: Epithelial cells of intestinal villas Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X
Western Blot: Ornithine Carbamoyltransferase Antibody [NBP1-54934]

Western Blot: Ornithine Carbamoyltransferase Antibody [NBP1-54934]

Western Blot: Ornithine Carbamoyltransferase Antibody [NBP1-54934] - Sample Tissue: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1.25ug/mL, Peptide Concentration: 1.0ug/mL, Lysate Quantity: 25ug/lane, Gel Concentration: 12%
Western Blot: Ornithine Carbamoyltransferase Antibody [NBP1-54934]

Western Blot: Ornithine Carbamoyltransferase Antibody [NBP1-54934]

Western Blot: Ornithine Carbamoyltransferase Antibody [NBP1-54934] - Sample Tissue: Human HepG2 Antibody Dilution: 1.0 ug/ml

Applications for Ornithine Carbamoyltransferase Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Ornithine Carbamoyltransferase/OTC

OTC is a mitochondrial matrix enzyme. Missense, nonsense, and frameshift mutations in this enzyme lead to ornithine transcarbamylase deficiency, which causes hyperammonemia. Since the gene for this enzyme maps close to that for Duchenne muscular dystrophy, it may play a role in that disease also.This nuclear gene encodes a mitochondrial matrix enzyme. Missense, nonsense, and frameshift mutations in this enzyme lead to ornithine transcarbamylase deficiency, which causes hyperammonemia. Since the gene for this enzyme maps close to that for Duchenne muscular dystrophy, it may play a role in that disease also.

Alternate Names

OCTD, Ornithine Transcarbamylase, OTC, OTCase

Gene Symbol

OTC

UniProt

Additional Ornithine Carbamoyltransferase/OTC Products

Product Documents for Ornithine Carbamoyltransferase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Ornithine Carbamoyltransferase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Ornithine Carbamoyltransferase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Ornithine Carbamoyltransferase Antibody - BSA Free and earn rewards!

Have you used Ornithine Carbamoyltransferase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...