OSBPL2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92237

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all OSBPL2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VEGHIQDKNKKKLFMIYGKWTECLWGIDPVSYESFKKQERRGDHLRKAKLDEDSGKADSDVADDVPVAQETVQVIPGSKL

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (80%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for OSBPL2 Antibody - BSA Free

Immunohistochemistry-Paraffin: OSBPL2 Antibody [NBP1-92237]

Immunohistochemistry-Paraffin: OSBPL2 Antibody [NBP1-92237]

Immunohistochemistry-Paraffin: OSBPL2 Antibody [NBP1-92237] - Staining of human duodenum shows cytoplasmic positivity in glandular cells.
OSBPL2 Antibody - BSA Free Western Blot: OSBPL2 Antibody - BSA Free [NBP1-92237]

Western Blot: OSBPL2 Antibody - BSA Free [NBP1-92237]

Analysis in control (vector only transfected HEK293T lysate) and OSBPL2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Applications for OSBPL2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: OSBPL2

OSBPL2 encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain, although some members contain only the sterol-binding domain. This encoded protein contains only the sterol-binding domain. In vitro studies have shown that the encoded protein can bind strongly to phosphatic acid and weakly to phosphatidylinositol 3-phosphate, but cannot bind to 25-hydroxycholesterol. The protein associates with the Golgi apparatus. Transcript variants encoding different isoforms have been described.

Alternate Names

KIAA0772FLJ20223, ORP-2MGC4307, ORP2MGC8342, OSBP-related protein 2, oxysterol binding protein-like 2, oxysterol-binding protein-like 2, oxysterol-binding protein-related protein 2

Gene Symbol

OSBPL2

Additional OSBPL2 Products

Product Documents for OSBPL2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for OSBPL2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for OSBPL2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review OSBPL2 Antibody - BSA Free and earn rewards!

Have you used OSBPL2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies