OSBPL3 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-82968
![Immunohistochemistry-Paraffin: OSBPL3 Antibody [NBP1-82968]](https://resources.rndsystems.com/images/products/OSBPL3-Antibody-Immunohistochemistry-Paraffin-NBP1-82968-img0014.jpg "Immunohistochemistry-Paraffin: OSBPL3 Antibody [NBP1-82968]")
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Cited:
Immunohistochemistry, IF/IHC
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TLDFGEEKNYSDGSETSSEFSKMQEDLCHIAHKVYFTLRSAFNIMSAEREKLKQLMEQDASSSPSAQVIGLKNALSSALAQNTDLKERLRRIHAESLLLDSPAVAKSGDNLAEE
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (87%)
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for OSBPL3 Antibody - BSA Free
![Western Blot: OSBPL3 Antibody [NBP1-82968]](https://resources.rndsystems.com/images/products/OSBPL3-Antibody-Western-Blot-NBP1-82968-img0011.jpg "Western Blot: OSBPL3 Antibody [NBP1-82968]")
![Immunocytochemistry/ Immunofluorescence: OSBPL3 Antibody [NBP1-82968]](https://resources.rndsystems.com/images/products/OSBPL3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82968-img0008.jpg "Immunocytochemistry/ Immunofluorescence: OSBPL3 Antibody [NBP1-82968]")
Immunocytochemistry/ Immunofluorescence: OSBPL3 Antibody [NBP1-82968]
Immunocytochemistry/Immunofluorescence: OSBPL3 Antibody [NBP1-82968] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoli & cytosol.![Immunohistochemistry-Paraffin: OSBPL3 Antibody [NBP1-82968]](https://resources.rndsystems.com/images/products/OSBPL3-Antibody-Immunohistochemistry-Paraffin-NBP1-82968-img0012.jpg "Immunohistochemistry-Paraffin: OSBPL3 Antibody [NBP1-82968]")
Immunohistochemistry-Paraffin: OSBPL3 Antibody [NBP1-82968]
Immunohistochemistry-Paraffin: OSBPL3 Antibody [NBP1-82968] - Staining of human pancreas shows low expression as expected.![Immunohistochemistry-Paraffin: OSBPL3 Antibody [NBP1-82968]](https://resources.rndsystems.com/images/products/OSBPL3-Antibody-Immunohistochemistry-Paraffin-NBP1-82968-img0013.jpg "Immunohistochemistry-Paraffin: OSBPL3 Antibody [NBP1-82968]")
Immunohistochemistry-Paraffin: OSBPL3 Antibody [NBP1-82968]
Immunohistochemistry-Paraffin: OSBPL3 Antibody [NBP1-82968] - Staining of human urinary bladder shows high expression.
Immunohistochemistry: OSBPL3 Antibody - BSA Free [NBP1-82968] -
Expression of OSBPL3 and Ki-67 in CRC samples detected by immunohistochemistry. a The pie chart shows the number of co-expression OSBPL3 and ki-67 in CRC samples. b Representative image of OSBPL3 and ki-67 score from weak to strong on normal intestinal epithelium and tumor tissues. Staining location: OSBPL3 staining is located in the nucleus and cytoplasm, and Ki-67 staining is located in the nucleus. The expression of Ki-67 was also weak in tissues with weak OSBPL3 expression; Ki-67 expression was also strong in tissues with strong expression of OSBPL3 (Magnification × 400) Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36517805), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for OSBPL3 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Western Blot
0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Reviewed Applications
Read 1 review rated 4 using NBP1-82968 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: OSBPL3
Alternate Names
DKFZp667P1518, KIAA0704ORP3ORP-3OSBP3, MGC21526, OSBP-related protein 3, oxysterol binding protein-like 3, oxysterol-binding protein 3, oxysterol-binding protein-related protein 3
Gene Symbol
OSBPL3
Additional OSBPL3 Products
Product Documents for OSBPL3 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for OSBPL3 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for OSBPL3 Antibody - BSA Free
Powered by Bioz
Customer Reviews for OSBPL3 Antibody - BSA Free (1)
4 out of 5
1 Customer Rating
Have you used OSBPL3 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
1 of
1 review
Showing All
Filter By:
-
Application: ImmunofluorescenceSample Tested: hela cellSpecies: HumanVerified Customer | Posted 11/01/2017
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...