p53 DINP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85108

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VEAQNEMGQHIHCYVAALAAHTTFLEQPKSFRPSQWIKEHSERQPLNRNSLRRQNLTRDCHPRQVKHNGWVVHQPC

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (82%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for p53 DINP1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: p53 DINP1 Antibody [NBP1-85108]

Immunocytochemistry/ Immunofluorescence: p53 DINP1 Antibody [NBP1-85108]

Immunocytochemistry/Immunofluorescence: p53 DINP1 Antibody [NBP1-85108] - Immunofluorescent staining of human cell line SH-SY5Y shows localization to cytosol.
Immunohistochemistry-Paraffin: p53 DINP1 Antibody [NBP1-85108]

Immunohistochemistry-Paraffin: p53 DINP1 Antibody [NBP1-85108]

Immunohistochemistry-Paraffin: p53 DINP1 Antibody [NBP1-85108] - Staining of human cerebral cortex shows nuclear positivity in both neuronal and glial cells.

Applications for p53 DINP1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: p53 DINP1

Apoptosis is related to many diseases and development. The p53 tumor-suppressor protein induces apoptosis through transcriptional activation of several genes. A novel p53 inducible gene was identified recently and designated p53DINP1 (for p53-dependent damage-inducible nuclear protein and SIP (for stress induced protein) in human and mouse. A p53DINP1 antisense oligonucleotide inhibits and overexpression of p53DINP1 enhances Ser46 phosphorylation of p53, induction of p53AIP1, and cell death induced by DNA double-strand breaks. p53DINP1 may regulate p53-dependent apoptosis through phosphorylation at Ser46 and induction of p53AIP1. The p53DINP1/SIP gene encodes two proteins of 27 and 18 kDa in human and mouse termed p53DINP1-a and p53DINP1-b or SIP27 and SIP18. p53DINP1/SIP is expressed in many tissues and induced by a variety of stress agents including UV stress, mutagenic stress, heat shock, and oxidative stress.

Alternate Names

DKFZp434M1317, FLJ22139, p53DINP1, P53DINP1p53-dependent damage-inducible nuclear protein 1, p53-inducible p53DINP1, SIPStress-induced protein, Teap, TP53DINP1, TP53INP1A, TP53INP1B, tumor protein p53 inducible nuclear protein 1, tumor protein p53-inducible nuclear protein 1

Gene Symbol

TP53INP1

Additional p53 DINP1 Products

Product Documents for p53 DINP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for p53 DINP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for p53 DINP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review p53 DINP1 Antibody - BSA Free and earn rewards!

Have you used p53 DINP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...