PA28 Activator beta Subunit/PSME2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57628

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (93%), Rat (90%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IPDPPPKDDEMETDKQEKKEVPKCGFLPGNEKVLSLLALVK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PA28 Activator beta Subunit/PSME2 Antibody - BSA Free

Western Blot: PA28 Activator beta Subunit/PSME2 Antibody [NBP2-57628]

Western Blot: PA28 Activator beta Subunit/PSME2 Antibody [NBP2-57628]

Western Blot: PA28 Activator beta Subunit/PSME2 Antibody [NBP2-57628] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: PA28 Activator beta Subunit/PSME2 Antibody [NBP2-57628]

Immunocytochemistry/ Immunofluorescence: PA28 Activator beta Subunit/PSME2 Antibody [NBP2-57628]

Immunocytochemistry/Immunofluorescence: PA28 Activator beta Subunit/PSME2 Antibody [NBP2-57628] - Staining of human cell line U-2 OS shows localization to nucleus.

Applications for PA28 Activator beta Subunit/PSME2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PA28 Activator beta Subunit

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. This gene encodes the beta subunit of the 11S regulator, one of the two 11S subunits that is induced by gamma-interferon. Three beta and three alpha subunits combine to form a heterohexameric ring. Six pseudogenes have been identified on chromosomes 4, 5, 8, 10 and 13.

Long Name

Proteasome (Prosome, Macropain) Activator Subunit 2

Alternate Names

MCP Activator, PSME2

Gene Symbol

PSME2

Additional PA28 Activator beta Subunit Products

Product Documents for PA28 Activator beta Subunit/PSME2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PA28 Activator beta Subunit/PSME2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PA28 Activator beta Subunit/PSME2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PA28 Activator beta Subunit/PSME2 Antibody - BSA Free and earn rewards!

Have you used PA28 Activator beta Subunit/PSME2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...