PAQR6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57962

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PAQR6 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YIGEGTPGPAREEAGADAFPEHRMNWATATSYSTSVQCWAPTSSWRQCWLIWDHAEPGWPHRNLPWAWQAQWPHWSWLQL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PAQR6 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: PAQR6 Antibody [NBP2-57962]

Immunocytochemistry/ Immunofluorescence: PAQR6 Antibody [NBP2-57962]

Immunocytochemistry/Immunofluorescence: PAQR6 Antibody [NBP2-57962] - Staining of human cell line MCF7 shows localization to nucleus & nucleoli. Antibody staining is shown in green.
Western Blot: PAQR6 Antibody [NBP2-57962]

Western Blot: PAQR6 Antibody [NBP2-57962]

Western Blot: PAQR6 Antibody [NBP2-57962] - Analysis in human cell line RT-4.

Applications for PAQR6 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

1:100 - 1:250
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PAQR6

The PAQR6 gene encodes a progestin and adipoQ receptor family member 6 that exists in four isoforms: isoform 1 is 344 amino acids long at 37 kDA, isoform 2 is 351 amino acids long at 39 kDA, isoform 3 is 238 amino acids long at 25 kDA, and isoform 4 is 320 amino acids long at 35 kDA. PAQR6 interacts with genes CAP1, SCP2, and COL11A1.

Alternate Names

progestin and adipoQ receptor family member 6, progestin and adipoQ receptor family member VIFLJ22672

Gene Symbol

PAQR6

Additional PAQR6 Products

Product Documents for PAQR6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PAQR6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PAQR6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PAQR6 Antibody - BSA Free and earn rewards!

Have you used PAQR6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies