Paralemmin Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79624

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Paralemmin Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human PALM. Peptide sequence LEDERRQLQHLKSKALRERWLLEGTPSSASEGDEDLRRQMQDDEQKTRLL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Paralemmin Antibody - BSA Free

Western Blot: Paralemmin Antibody [NBP1-79624]

Western Blot: Paralemmin Antibody [NBP1-79624]

Western Blot: Paralemmin Antibody [NBP1-79624] - Sample Type: Human Fetal Lung Antibody Dilution: 1.0 ug/ml
Western Blot: Paralemmin Antibody [NBP1-79624]

Western Blot: Paralemmin Antibody [NBP1-79624]

Western Blot: Paralemmin Antibody [NBP1-79624] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.
Western Blot: Paralemmin Antibody [NBP1-79624]

Western Blot: Paralemmin Antibody [NBP1-79624]

Western Blot: Paralemmin Antibody [NBP1-79624] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.

Applications for Paralemmin Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Paralemmin

Paralemmin encodes a member of the paralemmin protein family. The product of this gene is a prenylated and palmitoylated phosphoprotein that associates with the cytoplasmic face of plasma membranes and is implicated in plasma membrane dynamics in neurons and other cell types. Several alternatively spliced transcript variants have been identified, but the full-length nature of only two transcript variants has been determined.

Alternate Names

KIAA0270, paralemmin

Gene Symbol

PALM

UniProt

NP_001035224 (Human)

Additional Paralemmin Products

Product Documents for Paralemmin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Paralemmin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Paralemmin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Paralemmin Antibody - BSA Free and earn rewards!

Have you used Paralemmin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies