Parvalbumin Antibody (6C7K6)

Novus Biologicals | Catalog # NBP3-15664

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 6C7K6 expressed in HEK293
View all Parvalbumin Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human Parvalbumin (P20472). MSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Parvalbumin Antibody (6C7K6)

Western Blot: Parvalbumin Antibody (6C7K6) [NBP3-15664]

Western Blot: Parvalbumin Antibody (6C7K6) [NBP3-15664]

Western Blot: Parvalbumin Antibody (6C7K6) [NBP3-15664] - Analysis of extracts of various cell lines, using Parvalbumin (PVALB) antibody (NBP3-15664) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunohistochemistry-Paraffin: Parvalbumin Antibody (6C7K6) [NBP3-15664]

Immunohistochemistry-Paraffin: Parvalbumin Antibody (6C7K6) [NBP3-15664]

Immunohistochemistry-Paraffin: Parvalbumin Antibody (6C7K6) [NBP3-15664] - Mouse brain using Parvalbumin (PVALB) Rabbit mAb (NBP3-15664) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Parvalbumin Antibody (6C7K6) [NBP3-15664]

Immunohistochemistry-Paraffin: Parvalbumin Antibody (6C7K6) [NBP3-15664]

Immunohistochemistry-Paraffin: Parvalbumin Antibody (6C7K6) [NBP3-15664] - Rat brain using Parvalbumin (PVALB) Rabbit mAb (NBP3-15664) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Parvalbumin Antibody (6C7K6) [NBP3-15664]

Immunohistochemistry-Paraffin: Parvalbumin Antibody (6C7K6) [NBP3-15664]

Immunohistochemistry-Paraffin: Parvalbumin Antibody (6C7K6) [NBP3-15664] - Human appendix using Parvalbumin (PVALB) Rabbit mAb (NBP3-15664) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Parvalbumin Antibody (6C7K6)

Immunocytochemistry/ Immunofluorescence: Parvalbumin Antibody (6C7K6) [Parvalbumin] -

Immunocytochemistry/ Immunofluorescence: Parvalbumin Antibody (6C7K6) [Parvalbumin] - Confocal imaging of paraffin-embedded Rat brain tissue using Parvalbumin (PVALB) Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Microwave antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.
Parvalbumin Antibody (6C7K6)

Immunohistochemistry: Parvalbumin Antibody (6C7K6) [Parvalbumin] -

Immunohistochemistry: Parvalbumin Antibody (6C7K6) [Parvalbumin] - Immunohistochemistry analysis of paraffin-embedded Human kidney using Parvalbumin (PVALB) Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Parvalbumin Antibody (6C7K6)

Immunocytochemistry/ Immunofluorescence: Parvalbumin Antibody (6C7K6) [Parvalbumin] -

Immunocytochemistry/ Immunofluorescence: Parvalbumin Antibody (6C7K6) [Parvalbumin] - Confocal imaging of paraffin-embedded Human kidney tissue using Parvalbumin (PVALB) Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.
Parvalbumin Antibody (6C7K6)

Immunocytochemistry/ Immunofluorescence: Parvalbumin Antibody (6C7K6) [Parvalbumin] -

Immunocytochemistry/ Immunofluorescence: Parvalbumin Antibody (6C7K6) [Parvalbumin] - Confocal imaging of paraffin-embedded Mouse brain tissue using Parvalbumin (PVALB) Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Microwave antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.

Applications for Parvalbumin Antibody (6C7K6)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Parvalbumin

Parvalbumin is encoded by this gene is a high affinity calcium ion-binding protein that is structurally and functionally similar to calmodulin and troponin C. The encoded protein is thought to be involved in muscle relaxation.

Alternate Names

D22S749, MGC116759, parvalbumin, parvalbumin alpha, PV

Gene Symbol

PVALB

Additional Parvalbumin Products

Product Documents for Parvalbumin Antibody (6C7K6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Parvalbumin Antibody (6C7K6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Parvalbumin Antibody (6C7K6)

There are currently no reviews for this product. Be the first to review Parvalbumin Antibody (6C7K6) and earn rewards!

Have you used Parvalbumin Antibody (6C7K6)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Parvalbumin Antibody (6C7K6)

Showing  1 - 1 of 1 FAQ Showing All

  • Q: I am doing research on Neuroscience and I would like to use some antibodies, especially in Western Blots, but I could do other assays: - alpha7 nicotinic cholinergic receptor; - parvalbumin; - calbindin D28K; The preferred reactivity is anti-human and anti-mouse. Do you have these antibodies? Are they in stock? And what about the prizes: How much are they? How much are the shipping costs? Could you make me any offer?

    A:

    We currently have three alpha7 nicotinic cholingergic receptor antibodies available for purchase. Please see this list for our Parvalbumin antibodies. None are currently validated in mouse. I would like to introduce you to our Innovators Reward Program. We have an excelent calbinin D28K antibody that has been validated for use in human and mouse and WB. The pricing and availability of our products depends on your country.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies