PASK Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38589

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PASK Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1194-1323 of human PASK (NP_055963.2).

Sequence:
YTLVFEENPFCELEETVEAAIHPPYLVSKELMSLVSGLLQPVPERRTTLEKLVTDPWVTQPVNLADYTWEEVFRVNKPESGVLSAASLEMGNRSLSDVAQAQELCGGPVPGEAPNGQGCLHPGDPRLLTS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

143 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PASK Antibody - BSA Free

PASK Antibody

Immunocytochemistry/ Immunofluorescence: PASK Antibody [NBP3-38589] -

Immunocytochemistry/ Immunofluorescence: PASK Antibody [NBP3-38589] - Immunofluorescence analysis of L929 cells using PASK Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
PASK Antibody

Immunohistochemistry: PASK Antibody [NBP3-38589] -

Immunohistochemistry: PASK Antibody [NBP3-38589] - Immunohistochemistry analysis of paraffin-embedded Rat testis using PASK Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
PASK Antibody

Western Blot: PASK Antibody [NBP3-38589] -

Western Blot: PASK Antibody [NBP3-38589] - Western blot analysis of various lysates using PASK Rabbit pAb at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
PASK Antibody

Immunocytochemistry/ Immunofluorescence: PASK Antibody [NBP3-38589] -

Immunocytochemistry/ Immunofluorescence: PASK Antibody [NBP3-38589] - Immunofluorescence analysis of C6 cells using PASK Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
PASK Antibody

Immunohistochemistry: PASK Antibody [NBP3-38589] -

Immunohistochemistry: PASK Antibody [NBP3-38589] - Immunohistochemistry analysis of paraffin-embedded Human placenta using PASK Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Applications for PASK Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PASK

PASKIN (PAS-Kinase) is thought to regulate protein synthesis in cells. It is a conserved gene product found in yeast as well as mammals. PASKIN contains two domains (PAS A and PAS B) as well as a serine/threonine kinase domain related to AMP kinases. PASKIN activity leads to decreased carbohydrate storage, as well as increased protein synthesis. PASKIN-dependent phosphorylation inhibits the activity of mammalian glycogen synthase.

Alternate Names

DKFZp434O051, EC 2.7.11.1, hPASK, KIAA0135DKFZp686P2031, PAS domain containing serine/threonine kinase, PAS-kinase, PASKINPAS domain-containing serine/threonine-protein kinase, PAS-serine/threonine kinase, STK37

Gene Symbol

PASK

Additional PASK Products

Product Documents for PASK Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PASK Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PASK Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PASK Antibody - BSA Free and earn rewards!

Have you used PASK Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies