PCK2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33685

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (93%), Rat (96%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: NARVLDWICRRLEGEDSARETPIGLVPKEGALDLSGLRAIDTTQLFSLPKDFWEQEVRDIRSYLTEQVNQDLPKEVLAELE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PCK2 Antibody - BSA Free

Western Blot: PCK2 Antibody [NBP2-33685]

Western Blot: PCK2 Antibody [NBP2-33685]

Western Blot: PCK2 Antibody [NBP2-33685] - Analysis using Anti-PCK2 antibody NBP2-33685 (A) shows similar pattern to independent antibody NBP2-33606 (B).
Immunocytochemistry/ Immunofluorescence: PCK2 Antibody [NBP2-33685]

Immunocytochemistry/ Immunofluorescence: PCK2 Antibody [NBP2-33685]

Immunocytochemistry/Immunofluorescence: PCK2 Antibody [NBP2-33685] - Immunofluorescent staining of human cell line Hep G2 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PCK2 Antibody [NBP2-33685]

Immunohistochemistry-Paraffin: PCK2 Antibody [NBP2-33685]

Immunohistochemistry-Paraffin: PCK2 Antibody [NBP2-33685] - Staining of human liver.
Immunohistochemistry-Paraffin: PCK2 Antibody [NBP2-33685]

Immunohistochemistry-Paraffin: PCK2 Antibody [NBP2-33685]

Immunohistochemistry-Paraffin: PCK2 Antibody [NBP2-33685] - Staining of human duodenum shows high expression.
Immunohistochemistry-Paraffin: PCK2 Antibody [NBP2-33685]

Immunohistochemistry-Paraffin: PCK2 Antibody [NBP2-33685]

Immunohistochemistry-Paraffin: PCK2 Antibody [NBP2-33685] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: PCK2 Antibody [NBP2-33685]

Immunohistochemistry-Paraffin: PCK2 Antibody [NBP2-33685]

Immunohistochemistry-Paraffin: PCK2 Antibody [NBP2-33685] - Staining in human duodenum and skeletal muscle tissues using anti-PCK2 antibody. Corresponding PCK2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: PCK2 Antibody [NBP2-33685]

Immunohistochemistry-Paraffin: PCK2 Antibody [NBP2-33685]

Immunohistochemistry-Paraffin: PCK2 Antibody [NBP2-33685] - Staining of human cerebral cortex, colon, kidney and liver using Anti-PCK2 antibody NBP2-33685 (A) shows similar protein distribution across tissues to independent antibody NBP2-33606 (B).
Immunohistochemistry-Paraffin: PCK2 Antibody [NBP2-33685]

Immunohistochemistry-Paraffin: PCK2 Antibody [NBP2-33685]

Immunohistochemistry-Paraffin: PCK2 Antibody [NBP2-33685] - Staining of human colon.
Immunohistochemistry-Paraffin: PCK2 Antibody [NBP2-33685]

Immunohistochemistry-Paraffin: PCK2 Antibody [NBP2-33685]

Immunohistochemistry-Paraffin: PCK2 Antibody [NBP2-33685] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: PCK2 Antibody [NBP2-33685]

Immunohistochemistry-Paraffin: PCK2 Antibody [NBP2-33685]

Immunohistochemistry-Paraffin: PCK2 Antibody [NBP2-33685] - Staining of human kidney.

Applications for PCK2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PCK2

PCK2 encodes a member of the phosphoenolpyruvate carboxykinase (GTP) family. The protein is a mitochondrial enzyme that catalyzes the conversion of oxaloacetate to phosphoenolpyruvate in the presence of GTP. A cytosolic form encoded by a different gene has also been characterized and is the key enzyme of gluconeogenesis in the liver. The encoded protein may serve a similar function, although it is constitutively expressed and not modulated by hormones such as glucagon and insulin that regulate the cytosolic form. Alternatively spliced transcript variants have been described.

Alternate Names

EC 4.1.1.32, PE, PEPCK, PEPCK2PEP carboxykinase, PEPCK-M, phosphoenolpyruvate carboxykinase [GTP], mitochondrial, phosphoenolpyruvate carboxykinase 2 (mitochondrial), Phosphoenolpyruvate carboxylase, phosphopyruvate carboxylase

Gene Symbol

PCK2

UniProt

Additional PCK2 Products

Product Documents for PCK2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PCK2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PCK2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PCK2 Antibody - BSA Free and earn rewards!

Have you used PCK2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...