PDIA6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57999

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to PDIA6(protein disulfide isomerase family A, member 6) The peptide sequence was selected from the N terminal of PDIA6. Peptide sequence KNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSDSS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PDIA6 Antibody - BSA Free

Western Blot: PDIA6 Antibody [NBP1-57999]

Western Blot: PDIA6 Antibody [NBP1-57999]

Western Blot: PDIA6 Antibody [NBP1-57999] - Sample Type : Mouse Brain lysate
Western Blot: PDIA6 Antibody [NBP1-57999]

Western Blot: PDIA6 Antibody [NBP1-57999]

Western Blot: PDIA6 Antibody [NBP1-57999] - Mouse Brain lysate, Antibody Titration: 0.2-1 ug/ml
Western Blot: PDIA6 Antibody [NBP1-57999]

Western Blot: PDIA6 Antibody [NBP1-57999]

Western Blot: PDIA6 Antibody [NBP1-57999] - Titration: 2 ug/ml Positive Control: Human NT2 cell lysate
Western Blot: PDIA6 Antibody [NBP1-57999]

Western Blot: PDIA6 Antibody [NBP1-57999]

Western Blot: PDIA6 Antibody [NBP1-57999] - Sample Type: 2. mouse brain extracts (80ug) Primary Antibody Dilution: 2ug/ml Secondary Antibody: IRDye 800CW goat anti-rabbit Secondary Antibody Dilution: 1: 20,000
Western Blot: PDIA6 Antibody [NBP1-57999]

Western Blot: PDIA6 Antibody [NBP1-57999]

Western Blot: PDIA6 Antibody [NBP1-57999] - Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1 : 62500 Positive control: 721_B cell lysate PDIA6 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
Western Blot: PDIA6 Antibody [NBP1-57999]

Western Blot: PDIA6 Antibody [NBP1-57999]

Western Blot: PDIA6 Antibody [NBP1-57999] - Sample Tissue: Human Fetal Lung Antibody Dilution: 1.0 ug/ml

Applications for PDIA6 Antibody - BSA Free

Application
Recommended Usage

Immunoprecipitation

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PDIA6

Protein disulfide isomerases, such as PDIA6, are endoplasmic reticulum (ER) resident proteins that catalyze formation, reduction, and isomerization of disulfide bonds in proteins and are thought to play a role in folding of disulfide-bonded proteins.Protein disulfide isomerases (EC 5.3.4.1), such as PDIA6, are endoplasmic reticulum (ER) resident proteins that catalyze formation, reduction, and isomerization of disulfide bonds in proteins and are thought to play a role in folding of disulfide-bonded proteins (Hayano and Kikuchi, 1995 [PubMed 7590364]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-39 BF979486.1 11-49 40-1858 BC001312.1 1-1819 1859-2326 AK127433.1 2215-2682 2327-2344 BM511594.1 1-18 c

Alternate Names

EC 5.3.4.1, Endoplasmic reticulum protein 5, ERp5, ERP5ER protein 5, P5TXNDC7, protein disulfide isomerase family A, member 6, Protein disulfide isomerase P5, protein disulfide isomerase-associated 6, protein disulfide isomerase-related protein, protein disulfide-isomerase A6, thioredoxin domain containing 7 (protein disulfide isomerase), Thioredoxin domain-containing protein 7

Gene Symbol

PDIA6

UniProt

Additional PDIA6 Products

Product Documents for PDIA6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PDIA6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for PDIA6 Antibody - BSA Free

Customer Reviews for PDIA6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PDIA6 Antibody - BSA Free and earn rewards!

Have you used PDIA6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...