PELP1 Antibody (4F3) - Azide and BSA Free

Novus Biologicals | Catalog # H00027043-M06-100ug

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2b Kappa Clone # 4F3

Format

Azide and BSA Free
View all PELP1 Primary Antibodies »

Product Specifications

Immunogen

PELP1 (AAW80659.1, 337 a.a. ~ 410 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LNSWSIGRDSLSPGQERPYSTVRTKVYAILELWVQVCGASAGMLQGGASGEALLTHLLSDISPPADALKLRSPR

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2b Kappa

Scientific Data Images for PELP1 Antibody (4F3) - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: PELP1 Antibody (4F3) [H00027043-M06-100ug]

Immunocytochemistry/ Immunofluorescence: PELP1 Antibody (4F3) [H00027043-M06-100ug]

Immunocytochemistry/Immunofluorescence: PELP1 Antibody (4F3) [H00027043-M06-100ug] - PELP1 on HeLa cell. [antibody concentration 10 ug/ml].

Applications for PELP1 Antibody (4F3) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Protein A or G purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: PELP1

PELP1 is a coactivator of estrogen receptor (see ESR1; MIM 133430)-mediated transcription and a corepressor of other nuclear hormone receptors and sequence-specific transcription factors (Choi et al., 2004).[supplied by OMIM]

Alternate Names

HMX3, MNARmodulator of nongenomic activity of estrogen receptor, Modulator of non-genomic activity of estrogen receptor, P160, proline and glutamic acid rich nuclear protein, proline, glutamate and leucine rich protein 1, proline, glutamic acid and leucine rich protein 1, proline-, glutamic acid- and leucine-rich protein 1, proline-, glutamic acid-, leucine-rich protein 1, Transcription factor HMX3

Entrez Gene IDs

27043 (Human)

Gene Symbol

PELP1

OMIM

609455 (Human)

UniProt

AAW80659.1 (Human)

Additional PELP1 Products

Product Documents for PELP1 Antibody (4F3) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PELP1 Antibody (4F3) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PELP1 Antibody (4F3) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review PELP1 Antibody (4F3) - Azide and BSA Free and earn rewards!

Have you used PELP1 Antibody (4F3) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies