Pepsinogen C/PGC/Progastricsin Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-91011
![Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011]](https://resources.rndsystems.com/images/products/Pepsinogen-C-PGC-Progastricsin-Antibody-Immunohistochemistry-Paraffin-NBP1-91011-img0015.jpg "Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011]")
Loading...
Key Product Details
Validated by
Orthogonal Validation, Independent Antibodies
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Western Blot
Cited:
Immunohistochemistry-Frozen
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IQVPNQEFGLSENEPGTNFVYAQFDGIMGLAYPALSVDEATTAMQGMVQEGALTSPVFSVYLSNQQGSSGGAVVFGGVDSSLYTGQI
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Pepsinogen C/PGC/Progastricsin Antibody - BSA Free
![Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011]](https://resources.rndsystems.com/images/products/Pepsinogen-C-PGC-Progastricsin-Antibody-Immunohistochemistry-Paraffin-NBP1-91011-img0014.jpg "Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011]")
Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011]
Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011] - Staining of human cerebral cortex, colon, skeletal muscle and stomach using Anti-PGC antibody NBP1-91011 (A) shows similar protein distribution across tissues to independent antibody NBP1-91012 (B).![Western Blot: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011]](https://resources.rndsystems.com/images/products/Pepsinogen-C-PGC-Progastricsin-Antibody-Western-Blot-NBP1-91011-img0013.jpg "Western Blot: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011]")
Western Blot: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011]
Western Blot: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011] - Analysis in control (vector only transfected HEK293T lysate) and PGC over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).![Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011]](https://resources.rndsystems.com/images/products/Pepsinogen-C-PGC-Progastricsin-Antibody-Immunohistochemistry-Paraffin-NBP1-91011-img0019.jpg "Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011]")
Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011]
Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011] - Staining of human skeletal muscle shows no positivity in myocytes as expected.![Western Blot: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011]](https://resources.rndsystems.com/images/products/Pepsinogen-C-PGC-Progastricsin-Antibody-Western-Blot-NBP1-91011-img0009.jpg "Western Blot: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011]")
Western Blot: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011]
Western Blot: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011] - Analysis in human stomach tissue.![Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011]](https://resources.rndsystems.com/images/products/Pepsinogen-C-PGC-Progastricsin-Antibody-Immunohistochemistry-Paraffin-NBP1-91011-img0017.jpg "Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011]")
Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011]
Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.![Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011]](https://resources.rndsystems.com/images/products/Pepsinogen-C-PGC-Progastricsin-Antibody-Immunohistochemistry-Paraffin-NBP1-91011-img0018.jpg "Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011]")
Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011]
Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011] - Staining of human colon shows low positivity in glandular cells as expected.![Pepsinogen C/PGC/Progastricsin Antibody - BSA Free Western Blot: Pepsinogen C/PGC/Progastricsin Antibody - BSA Free [NBP1-91011]](https://resources.rndsystems.com/images/products/nbp1-91011_rabbit-polyclonal-pepsinogen-c-pgc-progastricsin-antibody-3052025959594.jpg "Western Blot: Pepsinogen C/PGC/Progastricsin Antibody - BSA Free [NBP1-91011]")
Western Blot: Pepsinogen C/PGC/Progastricsin Antibody - BSA Free [NBP1-91011]
Analysis in control (vector only transfected HEK293T lysate) and PGC over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).![Pepsinogen C/PGC/Progastricsin Antibody - BSA Free Immunohistochemistry: Pepsinogen C/PGC/Progastricsin Antibody - BSA Free [NBP1-91011]](https://resources.rndsystems.com/images/products/nbp1-91011_rabbit-polyclonal-pepsinogen-c-pgc-progastricsin-antibody-29520251619556.jpg "Immunohistochemistry: Pepsinogen C/PGC/Progastricsin Antibody - BSA Free [NBP1-91011]")
Immunohistochemistry: Pepsinogen C/PGC/Progastricsin Antibody - BSA Free [NBP1-91011]
Staining of human cerebral cortex shows no positivity in neurons as expected.![Pepsinogen C/PGC/Progastricsin Antibody - BSA Free Western Blot: Pepsinogen C/PGC/Progastricsin Antibody - BSA Free [NBP1-91011]](https://resources.rndsystems.com/images/products/nbp1-91011_rabbit-polyclonal-pepsinogen-c-pgc-progastricsin-antibody-30520257513012.jpg "Western Blot: Pepsinogen C/PGC/Progastricsin Antibody - BSA Free [NBP1-91011]")
Western Blot: Pepsinogen C/PGC/Progastricsin Antibody - BSA Free [NBP1-91011]
Analysis in human stomach tissue.Applications for Pepsinogen C/PGC/Progastricsin Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:500 - 1:1000
Immunohistochemistry-Paraffin
1:2500 - 1:5000
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. IHC-F reactivity reported in (PMID: 29925878).
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Pepsinogen C/PGC
Alternate Names
Gastricsin, PEPC, PGC, PGII
Gene Symbol
PGC
Additional Pepsinogen C/PGC Products
Product Documents for Pepsinogen C/PGC/Progastricsin Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Pepsinogen C/PGC/Progastricsin Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for Pepsinogen C/PGC/Progastricsin Antibody - BSA Free
Powered by Bioz
Customer Reviews for Pepsinogen C/PGC/Progastricsin Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Pepsinogen C/PGC/Progastricsin Antibody - BSA Free and earn rewards!
Have you used Pepsinogen C/PGC/Progastricsin Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...