Periaxin Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-89598
Key Product Details
Validated by
Species Reactivity
Validated:
Cited:
Applications
Validated:
Cited:
Label
Antibody Source
Format
Product Specifications
Immunogen
Clonality
Host
Isotype
Scientific Data Images for Periaxin Antibody - BSA Free
Immunohistochemistry-Paraffin: Periaxin Antibody - BSA Free [NBP1-89598]
Staining of human testis shows no positivity in cells in seminiferous ducts as expected.Immunohistochemistry-Paraffin: Periaxin Antibody - BSA Free [NBP1-89598]
Staining of human kidney shows strong membranous positivity in cells in glomeruli.Immunohistochemistry-Paraffin: Periaxin Antibody - BSA Free [NBP1-89598]
Staining of human liver shows no positivity in hepatocytes as expected.Immunohistochemistry-Paraffin: Periaxin Antibody - BSA Free [NBP1-89598]
Staining of human lung shows strong membranous positivity in pneumocytes.Applications for Periaxin Antibody - BSA Free
Immunohistochemistry-Paraffin
Reviewed Applications
Read 1 review rated 5 using NBP1-89598 in the following applications:
Formulation, Preparation, and Storage
Purification
Formulation
Format
Preservative
Concentration
Shipping
Stability & Storage
Background: Periaxin
Alternate Names
Gene Symbol
Additional Periaxin Products
Product Documents for Periaxin Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Periaxin Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for Periaxin Antibody - BSA Free
Customer Reviews for Periaxin Antibody - BSA Free (1)
Have you used Periaxin Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Customer Images
-
Application: Immunohistochemistry-FrozenSample Tested: Mouse sciatic nerveSpecies: MouseVerified Customer | Posted 07/13/2015Mouse sciatic nerve stained with periaxin (green) and DAPI (blue)
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for Periaxin Antibody - BSA Free
-
Q: Could you tell me if you expect the periaxin antibody NBP1-89598 to react with rat tissue?
A: This antibody has not been tested in rat. I performed a blast homology comparison to Rat with the immunogen and found only a 69% homology. However this has been validated in Mouse and Mouse only has a 72% homology and it seems to work fine. Mouse and rat are 92% homologous. The problem is that we cannot guarantee the antibody will work in rat but we can presume it will. This antibody was developed against Recombinant Protein corresponding to amino acids: MKVPDMKLPEIKLPKVPEMAVPDVHLPEVQLPKVSEIRLPEMQVPKVPDVHLPKAPEVKLPRAPEVQLKATKAEQAEGMEFGFKMPKMTMPKLGRAESPSRGKPGEAGAEVSGKLVTLPCLQPEVDGEAHVGVPSLTLPSVELDL