PERP Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85173

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLMEYAW

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (82%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PERP Antibody - BSA Free

Immunohistochemistry-Paraffin: PERP Antibody [NBP1-85173]

Immunohistochemistry-Paraffin: PERP Antibody [NBP1-85173]

Immunohistochemistry-Paraffin: PERP Antibody [NBP1-85173] - Staining of human esophagus shows very weak membranous positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: PERP Antibody [NBP1-85173]

Immunohistochemistry-Paraffin: PERP Antibody [NBP1-85173]

Immunohistochemistry-Paraffin: PERP Antibody [NBP1-85173] - Analysis in human skin and skeletal muscle tissues. Corresponding PERP RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: PERP Antibody [NBP1-85173]

Immunohistochemistry-Paraffin: PERP Antibody [NBP1-85173]

Immunohistochemistry-Paraffin: PERP Antibody [NBP1-85173] - Staining of human skin shows moderate to strong membranous positivity in stratum corneum.
Immunohistochemistry-Paraffin: PERP Antibody [NBP1-85173]

Immunohistochemistry-Paraffin: PERP Antibody [NBP1-85173]

Immunohistochemistry-Paraffin: PERP Antibody [NBP1-85173] - Staining of human lymph node shows no positivity as expected.
Immunohistochemistry-Paraffin: PERP Antibody [NBP1-85173]

Immunohistochemistry-Paraffin: PERP Antibody [NBP1-85173]

Immunohistochemistry-Paraffin: PERP Antibody [NBP1-85173] - Staining of human endometrium shows no positivity as expected.
Immunohistochemistry-Paraffin: PERP Antibody [NBP1-85173]

Immunohistochemistry-Paraffin: PERP Antibody [NBP1-85173]

Immunohistochemistry-Paraffin: PERP Antibody [NBP1-85173] - Staining of human skeletal muscle shows no positivity as expected.

Applications for PERP Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PERP

The p53 tumor suppressor activates either cell cycle arrest or apoptosis in response to cellular stress. A novel gene, PERP, is expressed in a p53-dependent manner and at high levels in apoptotic cells compared with G(1)-arrested cells. PERP induction is linked to p53-dependent apoptosis and is directly activated by p53. These data suggest that PERP is a novel effector of p53-dependent apoptosis.

Alternate Names

dJ496H19.1, KCP1KCP-1, Keratinocyte-associated protein 1, KRTCAP11110017A08Rik, p53 apoptosis effector related to PMP22, p53 apoptosis effector related to PMP-22, P53-induced protein PIGPC1, PERP, TP53 apoptosis effector, PIGPC1RP3-496H19.1, THWkeratinocytes associated protein 1, Transmembrane protein THW

Gene Symbol

PERP

Additional PERP Products

Product Documents for PERP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PERP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PERP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PERP Antibody - BSA Free and earn rewards!

Have you used PERP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...