PEX3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38838

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PEX3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: SLLDLEQKLKEIRNLVEQHKSSSWINKDGSKPLLCHYMMPDEETPLAVQACGLSPRDITTIKLLNETRDMLESPDFSTVLN

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (86%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PEX3 Antibody - BSA Free

Western Blot: PEX3 Antibody [NBP2-38838]

Western Blot: PEX3 Antibody [NBP2-38838]

Western Blot: PEX3 Antibody [NBP2-38838] - Analysis in control (vector only transfected HEK293T lysate) and PEX3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: PEX3 Antibody [NBP2-38838]

Immunohistochemistry-Paraffin: PEX3 Antibody [NBP2-38838]

Immunohistochemistry-Paraffin: PEX3 Antibody [NBP2-38838] - Staining in human adrenal gland and skeletal muscle tissues using anti-PEX3 antibody. Corresponding PEX3 RNA-seq data are presented for the same tissues.
Immunohistochemistry: PEX3 Antibody [NBP2-38838]

Immunohistochemistry: PEX3 Antibody [NBP2-38838]

Immunohistochemistry: PEX3 Antibody [NBP2-38838] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry: PEX3 Antibody [NBP2-38838]

Immunohistochemistry: PEX3 Antibody [NBP2-38838]

Immunohistochemistry: PEX3 Antibody [NBP2-38838] - Staining of human adrenal gland shows high expression.
Immunohistochemistry-Paraffin: PEX3 Antibody [NBP2-38838]

Immunohistochemistry-Paraffin: PEX3 Antibody [NBP2-38838]

Immunohistochemistry-Paraffin: PEX3 Antibody [NBP2-38838] - Staining of human skeletal muscle shows low expression as expected.

Applications for PEX3 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PEX3

The product of the PEX3 gene is involved in peroxisome biosynthesis and integrity. It assembles membrane vesicles before the matrix proteins are translocated. Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function. The peroxisomal biogenesis disorders are a heterogeneous group with at least 14 complementation groups and with more than 1 phenotype being observed in cases falling into particular complementation groups. Although the clinical features of PBD patients vary, cells from all PBD patients exhibit a defect in the import of one or more classes of peroxisomal matrix proteins into the organelle. Defects in this gene are a cause Zellweger syndrome (ZWS). (provided by RefSeq)

Alternate Names

DKFZp686N14184, FLJ13531, peroxin-3, Peroxisomal assembly protein PEX3, peroxisomal biogenesis factor 3, transformation-related protein 18, TRG18

Gene Symbol

PEX3

UniProt

P56589 (Human)

Additional PEX3 Products

Product Documents for PEX3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PEX3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PEX3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PEX3 Antibody - BSA Free and earn rewards!

Have you used PEX3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies