PGD2 Synthase/PTGDS Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79280

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human PTGDSThe immunogen for this antibody is PTGDS (NP_000945). Peptide sequence MATHHTLWMGLALLGVLGDLQAAPEAQVSVQPNFQQDKFLGRWFSAGLAS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PGD2 Synthase/PTGDS Antibody - BSA Free

Western Blot: PGD2 Synthase/PTGDS Antibody [NBP1-79280]

Western Blot: PGD2 Synthase/PTGDS Antibody [NBP1-79280]

Western Blot: PGD2 Synthase/PTGDS Antibody [NBP1-79280] - Titration: 1 ug/ml Positive Control: HepG2 cell lysate.
Immunohistochemistry-Paraffin: PGD2 Synthase/PTGDS Antibody [NBP1-79280]

Immunohistochemistry-Paraffin: PGD2 Synthase/PTGDS Antibody [NBP1-79280]

Immunohistochemistry-Paraffin: PGD2 Synthase/PTGDS Antibody [NBP1-79280] - Staining of mouse brain. Image provided by Allison Brager - Department of Neurobiology, Morehouse School of Medicine.
Immunohistochemistry-Paraffin: PGD2 Synthase/PTGDS Antibody [NBP1-79280]

Immunohistochemistry-Paraffin: PGD2 Synthase/PTGDS Antibody [NBP1-79280]

Immunohistochemistry-Paraffin: PGD2 Synthase/PTGDS Antibody [NBP1-79280] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Applications for PGD2 Synthase/PTGDS Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

4-8 ug/ml

Western Blot

1.0 ug/ml

Reviewed Applications

Read 1 review rated 5 using NBP1-79280 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PGD2 Synthase/PTGDS

Prostaglandin D Synthase (PTGDS), is a glutathione-independent prostaglandin D synthase that catalyzes the conversion of prostaglandin H2 (PGH2) to postaglandin D2 (PGD2). PGD2 functions as a neuromodulator as well as a trophic factor in the central nervous system. PGD2 is also involved in smooth muscle contraction/relaxation and is a potent inhibitor of platelet aggregation. PTGDS has also been implicated in the development and maintenance of the blood-brain, blood-retina, blood-aqueous humor and blood-testis barrier. Studies with transgenic mice overexpressing this gene suggest that this gene may be also involved in the regulation of non-rapid eye movement (NREM) sleep. It is likely to play important roles in both maturation and maintenance of the central nervous system and male reproductive system. PTGDS is the most abundant protein in the cerebral spinal fluid and recent evidence suggests that PTGDS acts as a Beta-Amyloid chaperone and may have a role in the deposition of amyloid-b plaques in Alzheimer's disease.

Long Name

Prostaglandin D2 Synthase

Alternate Names

Cerebrin-28, PDS, PGD2, PGDS2, PH2DISO, PTGDS

Entrez Gene IDs

5730 (Human); 19215 (Mouse); 25526 (Rat)

Gene Symbol

PTGDS

UniProt

Additional PGD2 Synthase/PTGDS Products

Product Documents for PGD2 Synthase/PTGDS Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PGD2 Synthase/PTGDS Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for PGD2 Synthase/PTGDS Antibody - BSA Free

Customer Reviews for PGD2 Synthase/PTGDS Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used PGD2 Synthase/PTGDS Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 1 of 1 review Showing All
Filter By:
  • Name: Anonymous
    Application: Immunohistochemistry-Paraffin
    Sample Tested: mouse brain
    Species: Mouse
    Verified Customer | Posted 08/08/2013
    PGD2 Synthase/PTGDS Antibody - BSA Free NBP1-79280

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PGD2 Synthase/PTGDS Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All
    • Q: We have selected NBP1-79280 as the PTGDS antibody for ICH-P in our research. We noticed that IHC-P HIER pH6 retrieval is recommended for NBP1-81291, but there is no recommended retrieval method for NBP1-79280. So we want to ask that whether it is unnecessary to perform any retrieval method for NBP1-79280 in IHC-P protocol for the human brain tissues?

      A: If an antigen retrieval method is not mentioned on the datasheet, it may be that it is not required. (The testing of this particular antibody is carried out for us by an external company, and so unfortunately I do not have all the details of the protocols used.) However, you may choose to carry out the antigen retrieval anyway, as it will only enhance the signal. We recommend the citrate buffer (pH 6) method described in our antigen retrieval protocol.
Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...