PGRMC1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-83220

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Human, Mouse, Rat

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Simple Western

Cited:

Western Blot, Immunocytochemistry/ Immunofluorescence, Simple Western, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: DQPAASGDSDDDEPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PGRMC1 Antibody - BSA Free

Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220]

Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220]

Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Staining of human breast cancer shows strong cytoplasmic positivity in tumor cells.
Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220]

Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220]

Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Staining of human endometrium shows moderate to strong cytoplasmic positivity in glandular and stromal cells.
Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220]

Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220]

Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220]

Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220]

Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220]

Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220]

Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220]

Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220]

Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.
Simple Western: PGRMC1 Antibody [NBP1-83220]

Simple Western: PGRMC1 Antibody [NBP1-83220]

Simple Western: PGRMC1 Antibody [NBP1-83220] - Simple Western lane view shows a specific band for PGRMC1 in 0.2 mg/ml of RT-4 (left) and U-251MG sp (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Simple Western: PGRMC1 Antibody [NBP1-83220]

Simple Western: PGRMC1 Antibody [NBP1-83220]

Simple Western: PGRMC1 Antibody [NBP1-83220] - Electropherogram image(s) of corresponding Simple Western lane view. PGRMC1 antibody was used at 1:20 dilution on RT-4 and U-251MG sp lysates(s).
PGRMC1 Antibody - BSA Free Immunohistochemistry-Paraffin: PGRMC1 Antibody - BSA Free [NBP1-83220]

Immunohistochemistry-Paraffin: PGRMC1 Antibody - BSA Free [NBP1-83220]

Analysis in human liver and skeletal muscle tissues using NBP1-83220 antibody. Corresponding PGRMC1 RNA-seq data are presented for the same tissues.
PGRMC1 Antibody - BSA Free Western Blot: PGRMC1 Antibody - BSA Free [NBP1-83220]

Western Blot: PGRMC1 Antibody - BSA Free [NBP1-83220]

Analysis in human liver tissue.
PGRMC1 Antibody - BSA Free Western Blot: PGRMC1 Antibody - BSA Free [NBP1-83220]

Western Blot: PGRMC1 Antibody - BSA Free [NBP1-83220]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
PGRMC1 Antibody - BSA Free Western Blot: PGRMC1 Antibody - BSA Free [NBP1-83220]

Western Blot: PGRMC1 Antibody - BSA Free [NBP1-83220]

Analysis in human cell line HEK 293.

Applications for PGRMC1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500-1:1000

Simple Western

1:20

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC-Paraffin HIER pH6 retrieval is recommended. See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG, separated by Size, antibody dilution of 1:20, apparent MW was 35 kDa

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PGRMC1

Progesterone binding protein is a putative steroid membrane receptor. The protein is expressed predominantly in the liver and kidney.

Long Name

Progesterone Receptor Membrane Component 1

Alternate Names

HPR6.6, MPR, Progesterone Binding Protein

Gene Symbol

PGRMC1

Additional PGRMC1 Products

Product Documents for PGRMC1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PGRMC1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for PGRMC1 Antibody - BSA Free

Customer Reviews for PGRMC1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PGRMC1 Antibody - BSA Free and earn rewards!

Have you used PGRMC1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...