PHD4/HIF Prolyl Hydroxylase 4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-83989

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PHD4/HIF Prolyl Hydroxylase 4 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KADPDGDGVLSLQEFSNMDLRDFHKYMRSHKAESSELVRNSHHTWLYQGEGAHHIMRAIRQRVLRLTRLSPEIVELSEPLQVVRYGEGGHYHAHVDSGPVYPETICSHTKLVANESVPFETSCRQVSPNWGLPSILRPGTP

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (86%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PHD4/HIF Prolyl Hydroxylase 4 Antibody - BSA Free

PHD4/HIF Prolyl Hydroxylase 4 Antibody - BSA Free Western Blot: PHD4/HIF Prolyl Hydroxylase 4 Antibody - BSA Free [NBP1-83989]

Western Blot: PHD4/HIF Prolyl Hydroxylase 4 Antibody - BSA Free [NBP1-83989]

Analysis in human cell line HeLa.
PHD4/HIF Prolyl Hydroxylase 4 Antibody - BSA Free Immunohistochemistry-Paraffin: PHD4/HIF Prolyl Hydroxylase 4 Antibody - BSA Free [NBP1-83989]

Immunohistochemistry-Paraffin: PHD4/HIF Prolyl Hydroxylase 4 Antibody - BSA Free [NBP1-83989]

Staining of human cerebellum shows strong cytoplasmic/membranous granular positivity in Purkinje cells and molecular layer cells.
PHD4/HIF Prolyl Hydroxylase 4 Antibody - BSA Free Immunohistochemistry-Paraffin: PHD4/HIF Prolyl Hydroxylase 4 Antibody - BSA Free [NBP1-83989]

Immunohistochemistry-Paraffin: PHD4/HIF Prolyl Hydroxylase 4 Antibody - BSA Free [NBP1-83989]

Staining of human pancreas shows strong cytoplasmic/membranous positivity in exocrine glandular cells and moderate cytoplasmic/membranous positivity in endocrine glandular cells.
PHD4/HIF Prolyl Hydroxylase 4 Antibody - BSA Free Immunohistochemistry-Paraffin: PHD4/HIF Prolyl Hydroxylase 4 Antibody - BSA Free [NBP1-83989]

Immunohistochemistry-Paraffin: PHD4/HIF Prolyl Hydroxylase 4 Antibody - BSA Free [NBP1-83989]

Staining of human cerebral cortex shows strong cytoplasmic membranous/granular positivity in neurons.
PHD4/HIF Prolyl Hydroxylase 4 Antibody - BSA Free Immunohistochemistry-Paraffin: PHD4/HIF Prolyl Hydroxylase 4 Antibody - BSA Free [NBP1-83989]

Immunohistochemistry-Paraffin: PHD4/HIF Prolyl Hydroxylase 4 Antibody - BSA Free [NBP1-83989]

Staining of human placenta shows strong cytoplasmic/membranous positivity in trophoblastic cells and decidual cells.

Applications for PHD4/HIF Prolyl Hydroxylase 4 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PHD4/HIF Prolyl Hydroxylase 4

Prolyl hydroxylase 4 is a prolyl hydroxylase that modifies HIF-alpha. Classic prolyl hydroxylases are found in the endoplasmic reticulum and modify collagen, whereas HIF is an intracellular protein and the prolyl hydroxylase sites do not resemble those modifying collagen. HIF is a transcriptional complex that plays a critical role in oxygen homeostasis. Prolyl hydroxylase is an essential component of the pathway through which cells sense oxygen. In the presence of oxygen, prolyl hydroxylases convert specific prolyl residues in HIF-alpha to hydroxyproline, leading to HIF-alpha destruction. Low oxygen levels, sensed at the cellular level, cause the HIF conversion to be reduced so that HIF is stable and there is increased angiogenesis. Prolyl hydroxylase 4, specifically, catalyzes the post-translational formation of 4-hydroxyproline in HIF alpha proteins. It may function as a cellular oxygen sensor and, under normoxic conditions, may targets HIF through the hydroxylation for proteasomal degradation via the von Hippel-Lindau ubiquitylation complex.

Alternate Names

EC 1.14.11.-, EGLN4, HIFPH4, HIF-PH4, HIF-prolyl hydroxylase 4, HPH-4, hypoxia-inducible factor prolyl 4-hydroxylase, Hypoxia-inducible factor prolyl hydroxylase 4, P4H with transmembrane domain, P4H-TMFLJ20262, PH-4, PH4 hypoxia inducible factor prolyl 4 hydroxylase, PHD4, proline 4-hydroxylase, prolyl 4-hydroxylase, transmembrane (endoplasmic reticulum), Prolyl hydroxlase domain-containing 4, transmembrane prolyl 4-hydroxylase

Gene Symbol

P4HTM

Additional PHD4/HIF Prolyl Hydroxylase 4 Products

Product Documents for PHD4/HIF Prolyl Hydroxylase 4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PHD4/HIF Prolyl Hydroxylase 4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PHD4/HIF Prolyl Hydroxylase 4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PHD4/HIF Prolyl Hydroxylase 4 Antibody - BSA Free and earn rewards!

Have you used PHD4/HIF Prolyl Hydroxylase 4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies