Phospholipid Scramblase 1/PLSCR1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57816

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to PLSCR1(phospholipid scramblase 1) Antibody(against the N terminal of PLSCR1. Peptide sequence MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPP. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Phospholipid Scramblase 1/PLSCR1 Antibody - BSA Free

Western Blot: Phospholipid Scramblase 1/PLSCR1 Antibody [NBP1-57816]

Western Blot: Phospholipid Scramblase 1/PLSCR1 Antibody [NBP1-57816]

Western Blot: Phospholipid Scramblase 1/PLSCR1 Antibody [NBP1-57816] - Human 721_B, Antibody Dilution: 1.0 ug/ml PLSCR1 is supported by BioGPS gene expression data to be expressed in 721_B.
Immunohistochemistry: Phospholipid Scramblase 1/PLSCR1 Antibody [NBP1-57816]

Immunohistochemistry: Phospholipid Scramblase 1/PLSCR1 Antibody [NBP1-57816]

Immunohistochemistry: Phospholipid Scramblase 1/PLSCR1 Antibody [NBP1-57816] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Nucleus Primary Antibody Concentration: N/A Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec
Western Blot: Phospholipid Scramblase 1/PLSCR1 Antibody [NBP1-57816]

Western Blot: Phospholipid Scramblase 1/PLSCR1 Antibody [NBP1-57816]

Western Blot: Phospholipid Scramblase 1/PLSCR1 Antibody [NBP1-57816] - Hela cell lysate, concentration 0.2-1 ug/ml.
Western Blot: Phospholipid Scramblase 1/PLSCR1 Antibody [NBP1-57816]

Western Blot: Phospholipid Scramblase 1/PLSCR1 Antibody [NBP1-57816]

Western Blot: Phospholipid Scramblase 1/PLSCR1 Antibody [NBP1-57816] - Human 293T, Antibody Dilution: 1.0 ug/ml PLSCR1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.

Applications for Phospholipid Scramblase 1/PLSCR1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Phospholipid Scramblase 1/PLSCR1

PLSCR1 may mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane.PLSCR1 may play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system.

Alternate Names

MMTRA1B, PLSCR1

Gene Symbol

PLSCR1

UniProt

Additional Phospholipid Scramblase 1/PLSCR1 Products

Product Documents for Phospholipid Scramblase 1/PLSCR1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Phospholipid Scramblase 1/PLSCR1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Phospholipid Scramblase 1/PLSCR1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Phospholipid Scramblase 1/PLSCR1 Antibody - BSA Free and earn rewards!

Have you used Phospholipid Scramblase 1/PLSCR1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...