PHOX2A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-62721

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (97%), Rat (97%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PHOX2A Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: AAELLKAWQPAESGPGPFSGVLSSFHRKPGPALKTNLF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PHOX2A Antibody - BSA Free

Immunohistochemistry-Paraffin: PHOX2A Antibody [NBP2-62721]

Immunohistochemistry-Paraffin: PHOX2A Antibody [NBP2-62721]

Immunohistochemistry-Paraffin: PHOX2A Antibody [NBP2-62721] - Staining of human adrenal gland shows high expression.
Immunohistochemistry-Paraffin: PHOX2A Antibody [NBP2-62721]

Immunohistochemistry-Paraffin: PHOX2A Antibody [NBP2-62721]

Immunohistochemistry-Paraffin: PHOX2A Antibody [NBP2-62721] - Analysis in human adrenal gland and liver tissues using Anti-PHOX2A antibody. Corresponding PHOX2A RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: PHOX2A Antibody [NBP2-62721]

Immunohistochemistry-Paraffin: PHOX2A Antibody [NBP2-62721]

Immunohistochemistry-Paraffin: PHOX2A Antibody [NBP2-62721] - Staining of human liver shows low expression as expected.

Applications for PHOX2A Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PHOX2A

PHOX2A is encoded by this gene contains a paired-like homeodomain most similar to that of the Drosophila aristaless gene product. The encoded protein plays a central role in development of the autonomic nervous system. It regulates the expression of tyrosine hydroxylase and dopamine beta-hydroxylase, two catecholaminergic biosynthetic enzymes essential for the differentiation and maintenance of the noradrenergic neurotransmitter phenotype. The encoded protein has also been shown to regulate transcription of the alpha3 nicotinic acetylcholine receptor gene. Mutations in this gene have been associated with autosomal recessive congenital fibrosis of the extraocular muscles.

Alternate Names

aristaless (Drosophila) homeobox, aristaless homeobox (Drosophila), fibrosis ofextraocular muscles, congenital, 2, autosomal recessive, aristaless homeobox homolog, Aristaless homeobox protein homolog, arix homeodomain protein, ARIX1 homeodomain protein, ARIXNCAM2, CFEOM2MGC52227, paired mesoderm homeobox protein 2A, paired-like homeobox 2apaired-like (aristaless) homeobox 2a, PMX2AFEOM2

Gene Symbol

PHOX2A

Additional PHOX2A Products

Product Documents for PHOX2A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PHOX2A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PHOX2A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PHOX2A Antibody - BSA Free and earn rewards!

Have you used PHOX2A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies