Recombinant Human PIWIL1/HIWI GST (N-Term) Protein

Novus Biologicals | Catalog # H00009271-Q01

Novus Biologicals
Loading...

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Applications

Western Blot, ELISA, Affinity Purification, Microarray
Loading...

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 431-541 of Human PIWIL1/HIWI

Source: Wheat Germ (in vitro)

Amino Acid Sequence: NDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVDDRTEAY

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

37.95 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human PIWIL1/HIWI GST (N-Term) Protein

Recombinant Human PIWIL1/HIWI Protein [H00009271-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation, and Storage

H00009271-Q01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: PIWIL1/HIWI

This gene encodes a member of the PIWI subfamily of Argonaute proteins, evolutionarily conserved proteins containing both PAZ and Piwi motifs that play important roles in stem cell self-renewal, RNA silencing, and translational regulation in diverse organisms. The encoded protein may play a role as an intrinsic regulator of the self-renewal capacity of germline and hematopoietic stem cells. [provided by RefSeq]

Long Name

Piwi-like Protein 1

Alternate Names

HIWI, MIWI

Gene Symbol

PIWIL1

Additional PIWIL1/HIWI Products

Product Documents for Recombinant Human PIWIL1/HIWI GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Human PIWIL1/HIWI GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Recombinant Human PIWIL1/HIWI GST (N-Term) Protein

There are currently no reviews for this product. Be the first to review Recombinant Human PIWIL1/HIWI GST (N-Term) Protein and earn rewards!

Have you used Recombinant Human PIWIL1/HIWI GST (N-Term) Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes
Loading...