Plakophilin 4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55977

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Rat (90%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Plakophilin 4 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SYSDSGYQEAGSFHNSQNVSKADNRQQHSFIGSTNNHVVRNSRAEGQTLVQPSVANRAMRRVSSVPSRAQSPSYVISTGVSPSR

Reactivity Notes

Mouse 89%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Plakophilin 4 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Plakophilin 4 Antibody [NBP2-55977]

Immunocytochemistry/ Immunofluorescence: Plakophilin 4 Antibody [NBP2-55977]

Immunocytochemistry/Immunofluorescence: Plakophilin 4 Antibody [NBP2-55977] - Staining of human cell line Hep G2 shows localization to cell junctions.

Applications for Plakophilin 4 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Plakophilin 4

Plakophilin 4, also known by its gene name PKP4, has multiple transcript variants, however only two have been fully characterized. Isoform 1 has 1,192 amino acids and is approximately 132 kDa and the shorter 1,149 amino acid long isoform is approximately 127 kDa. Plakophilin 4 is a member of the Beta Catenin family and the Plakophilin subfamily of Armadillo-like proteins. Plakophilin 4 regulates Rho activity during cytokinesis and may be implicated in the regulation of junctional plaques. Current research on Plakophilin 4 is being performed relating to several diseases and disorders including Alzheimer's Disease, schizophrenia, renal cell carcinoma and cardiomyopathy. PKP4 interacts with Presenilin 1, Erbin, OSGEP, Desmoplakin and GABARAP.

Alternate Names

catenin 4, FLJ42243, p0071FLJ31261, plakophilin 4, plakophilin-4

Gene Symbol

PKP4

Additional Plakophilin 4 Products

Product Documents for Plakophilin 4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Plakophilin 4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Plakophilin 4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Plakophilin 4 Antibody - BSA Free and earn rewards!

Have you used Plakophilin 4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies