PLGRKT Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89254

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PLGRKT Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: QKEFMLMNARLQLERQLIMQSEMRERQMAMQIAWSRE

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (89%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PLGRKT Antibody - BSA Free

Western Blot: PLGRKT Antibody [NBP1-89254]

Western Blot: PLGRKT Antibody [NBP1-89254]

Western Blot: PLGRKT Antibody [NBP1-89254] - Analysis in control (vector only transfected HEK293T lysate) and PLGRKT over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: PLGRKT Antibody [NBP1-89254]

Immunohistochemistry-Paraffin: PLGRKT Antibody [NBP1-89254]

Immunohistochemistry-Paraffin: PLGRKT Antibody [NBP1-89254] - Staining of human pancreas shows low positivity as expected.
Western Blot: PLGRKT Antibody [NBP1-89254]

Western Blot: PLGRKT Antibody [NBP1-89254]

Western Blot: PLGRKT Antibody [NBP1-89254] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunohistochemistry-Paraffin: PLGRKT Antibody [NBP1-89254]

Immunohistochemistry-Paraffin: PLGRKT Antibody [NBP1-89254]

Immunohistochemistry-Paraffin: PLGRKT Antibody [NBP1-89254] - Analysis in human rectum and pancreas tissues. Corresponding PLGRKT RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: PLGRKT Antibody [NBP1-89254]

Immunohistochemistry-Paraffin: PLGRKT Antibody [NBP1-89254]

Immunohistochemistry-Paraffin: PLGRKT Antibody [NBP1-89254] - Staining of human Fallopian tube shows moderate cytoplasmic/membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: PLGRKT Antibody [NBP1-89254]

Immunohistochemistry-Paraffin: PLGRKT Antibody [NBP1-89254]

Immunohistochemistry-Paraffin: PLGRKT Antibody [NBP1-89254] - Staining of human kidney shows moderate cytoplasmic positivity in cells in distal tubules.
Immunohistochemistry-Paraffin: PLGRKT Antibody [NBP1-89254]

Immunohistochemistry-Paraffin: PLGRKT Antibody [NBP1-89254]

Immunohistochemistry-Paraffin: PLGRKT Antibody [NBP1-89254] - Staining of human rectum shows moderate cytoplasmic/membranous positivity in glandular cells.

Applications for PLGRKT Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PLGRKT

Plasminogen is the precursor of plasmin, an active serine protease that dissolves the fibrin of blood clots and acts in many other processes such as embryonic development, tissue remodeling, inflammation and tumor invasion. Synthesized in the kidney, plasminogen is found in plasma and many extracellular fluids. Activated by u- or t-plasminogen activator, the single-chain plasminogen is converted to plasmin that consists of a disulfide bond-linked heavy chain A and light chain B. Heavy chain A contains 5 kringle domains and light chain B corresponds to the serine protease domain. A fragment consisting of the first 4 kringle domains has been named angiostatin, a novel angiogenesis inhibitor.

Long Name

Plasminogen Receptor (KT)

Alternate Names

C9orf46, MDS030, PLG-RKT

Entrez Gene IDs

55848 (Human)

Gene Symbol

PLGRKT

Additional PLGRKT Products

Product Documents for PLGRKT Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PLGRKT Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PLGRKT Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PLGRKT Antibody - BSA Free and earn rewards!

Have you used PLGRKT Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies