PMCA4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-31984

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: THPEFAIEEELPRTPLLDEEEEENPDKASKFGTRVLLLDGEVTPYANTNNNAVDCNQVQLPQSDSSLQSLETSV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PMCA4 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: PMCA4 Antibody [NBP2-31984]

Immunocytochemistry/ Immunofluorescence: PMCA4 Antibody [NBP2-31984]

Immunocytochemistry/Immunofluorescence: PMCA4 Antibody [NBP2-31984] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane.
Immunohistochemistry-Paraffin: PMCA4 Antibody [NBP2-31984]

Immunohistochemistry-Paraffin: PMCA4 Antibody [NBP2-31984]

Immunohistochemistry-Paraffin: PMCA4 Antibody [NBP2-31984] - Staining in human fallopian tube and pancreas tissues using anti-ATP2B4 antibody. Corresponding ATP2B4 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: PMCA4 Antibody [NBP2-31984]

Immunohistochemistry-Paraffin: PMCA4 Antibody [NBP2-31984]

Immunohistochemistry-Paraffin: PMCA4 Antibody [NBP2-31984] - Staining of human fallopian tube shows high expression.
Immunohistochemistry-Paraffin: PMCA4 Antibody [NBP2-31984]

Immunohistochemistry-Paraffin: PMCA4 Antibody [NBP2-31984]

Immunohistochemistry-Paraffin: PMCA4 Antibody [NBP2-31984] - Staining of human pancreas shows low expression as expected.

Applications for PMCA4 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PMCA4

The protein encoded by the PMCA4 gene belongs to the family of P-type primary ion transport ATPases characterized by theformation of an aspartyl phosphate intermediate during the reaction cycle. These enzymes remove bivalent calcium ionsfrom eukaryotic cells against very large concentration gradients and play a critical role in intracellular calciumhomeostasis. The mammalian plasma membrane calcium ATPase isoforms are encoded by at least four separate genes and thediversity of these enzymes is further increased by alternative splicing of transcripts. The expression of differentisoforms and splice variants is regulated in a developmental, tissue- and cell type-specific manner, suggesting thatthese pumps are functionally adapted to the physiological needs of particular cells and tissues. This gene encodes theplasma membrane calcium ATPase isoform 4. Alternatively spliced transcript variants encoding different isoforms havebeen identified. (provided by RefSeq)

Alternate Names

ATP2B2plasma membrane calcium ATPase, ATPase, Ca++ transporting, plasma membrane 4, DKFZp686G08106, DKFZp686M088, EC 3.6.3, EC 3.6.3.8, Matrix-remodeling-associated protein 1, matrix-remodelling associated 1, MXRA1, Plasma membrane calcium ATPase isoform 4, plasma membrane calcium pump, Plasma membrane calcium pump isoform 4, plasma membrane calcium-transporting ATPase 4, PMCA4b, PMCA4PMCA4x, sarcolemmal calcium pump

Gene Symbol

ATP2B4

UniProt

Additional PMCA4 Products

Product Documents for PMCA4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PMCA4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PMCA4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PMCA4 Antibody - BSA Free and earn rewards!

Have you used PMCA4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...